KEGG   Frankia sp. CcI3: Francci3_3752Help
Entry
Francci3_3752     CDS       T00320                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fra  Frankia sp. CcI3
Pathway
fra00521  Streptomycin biosynthesis
fra00523  Polyketide sugar unit biosynthesis
fra01130  Biosynthesis of antibiotics
Module
fra_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Francci3_3752
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Francci3_3752
Enzymes [BR:fra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Francci3_3752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABD13103
RhizoBase: Francci3_3752
UniProt: Q2J6I9
Position
4501668..4502291
Genome map
AA seq 207 aa AA seqDB search
MEISELSVPDAWVFTPRQHSDSRGTFLEWFRSDALAEAVGHPLTLSQANHSVSRAGTLRG
VHYAQVPPSQAKYVTCVHGRVLDCVVDIRVGSPTYGTFAAVVLDDVDRRGLYVAEGLGHA
FMALTDDAAISYLCSTPYTPGREYGVHPLDPDLALPWPDDLAPLLSDKDTAAPSLKEAEA
AGLLPDYRACRALYAELRSASAAGDIR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcagcgaactatcggttccggacgcctgggtgttcaccccgcgccagcactcc
gacagccgcgggaccttcctggagtggttccgctcggacgctctcgccgaggcggtgggg
catccgctcaccctgtcgcaggccaaccacagcgtgagccgggccggcacgctgcgcggg
gtgcactacgcgcaggtcccccccagccaggcgaagtacgtgacgtgcgtgcacggccgg
gtgctggactgcgtcgtcgacatcagggtcggctcaccgacctacgggacgttcgcggcg
gtcgtcctcgacgacgtcgaccggcggggcctgtacgtcgcggagggtctcgggcatgcc
ttcatggcgctcaccgacgacgccgcgatctcctacctgtgctcgactccgtataccccc
gggcgcgagtacggggtccacccactcgatcccgatctcgcgctgccctggcccgacgat
ctcgcgccgttgctgtccgacaaggacaccgcggcgccgtcgctcaaggaggcggaggcg
gctggcctgctgcccgactatcgcgcctgccgggccctgtacgccgagctccgctcggcg
agcgccgccggggacatccggtga

DBGET integrated database retrieval system