KEGG   Frankia sp. CcI3: Francci3_4026Help
Entry
Francci3_4026     CDS       T00320                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00620  Pyruvate metabolism
fra00640  Propanoate metabolism
fra00680  Methane metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_4026
   00620 Pyruvate metabolism
    Francci3_4026
   00640 Propanoate metabolism
    Francci3_4026
  Energy metabolism
   00680 Methane metabolism
    Francci3_4026
Enzymes [BR:fra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Francci3_4026
Lipid biosynthesis proteins [BR:fra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Francci3_4026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABD13376
RhizoBase: Francci3_4026
UniProt: Q2J5R6
Position
4812352..4814061
Genome map
AA seq 569 aa AA seqDB search
MTSTAATETYRTARDLLINLRTDYGKALEEFRWPRFEGQFNWAIDWFDPIARNNDRVALW
IVEEDGSERRCTYDEMARRSDRVATWLAGLGIGKGDPVILMLGNQVELWESMLALMKLGA
VIIPTTTAIGPTDLADRIERGGATCVIANAADAVKVKLKNLNGVIVGGEAAGWRPYTEAN
GVTEVHRFESRTAPTDPLLFYFTSGTTSRPKLVEHSQVSYPVGHLSTLYWTGVQPGDVHL
NISSPGWAKHAWSSFFVPWIAEATIFVYNYGTFDPAKLLAQLRRAGVTTMCAPPTVWRML
IKVDLSGGPGALREVLSAGEPLNPEVIDQVRAHWGLTLRDGFGQTETTAQVGNSPGAAVK
PGSMGRPLPGVPTVLVDPVSGQRSSTEGELCLDLAAHPLALMTSYRGDPERNAEVLAGGY
YHTGDVASLDEDGYLTYIGRTDDVFKASDYKVSPFELESVLVEHPAVLEAAVVPAPDEVR
LAVPKAYIALAPGWEPNRETAEAILRHARENLAPYLRVRRLEFYDLPKTISGKIRRVELR
SRESEAAGTRLSMEYRDTDFPRLTSRKAD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgactgccgcgaccgagacctaccgcactgcccgcgatcttctgatcaacttg
cgcacggactacggcaaggcgctggaggagttccgctggccacggttcgaaggccagttc
aactgggccatcgactggtttgacccaatcgcccggaacaacgaccgggtggcgctgtgg
atcgtggaagaggatggttcggaacgtcggtgcacctatgacgagatggcccgtcgctcg
gaccgggtagcgacctggcttgccgggttaggcatcggcaagggcgatccggtgatcctc
atgctcggcaaccaggtggagctctgggagtcgatgctggcgctcatgaagctgggcgcg
gtaatcatacccaccactaccgcgatcggtccgacggacctcgccgaccggatcgaacgc
ggcggcgccacctgcgtgatcgccaatgccgccgacgcggtgaaggtcaagctgaaaaac
ctgaacggtgtcattgtaggtggcgaggccgccggctggcgcccctacaccgaggccaac
ggcgtcaccgaggtgcaccggttcgaatcccgtaccgcccccaccgatccgctgctgttc
tacttcacctccggaaccaccagccggcccaaactcgtcgagcacagccaggtgtcctat
ccggtcgggcacctgtccaccctgtactggaccggggtgcaacccggtgacgtgcatctc
aacatcagttcccctggctgggcaaagcacgcgtggagctcgtttttcgtgccgtggatc
gccgaagcaacgatcttcgtctacaactacggcacgttcgaccccgccaagctgctggcg
cagctccgccgggctggcgtaaccacgatgtgcgcgccgccgaccgtgtggcgcatgctc
atcaaggtcgatctttccggcgggcccggcgcgctgcgcgaggtgctgtcggccggtgaa
cccctcaatccggaggtcatcgaccaggtccgcgcccactggggcctgaccctgcgcgac
gggttcggccaaaccgagacgaccgcccaggtcggcaactcacctggcgccgccgtcaag
ccggggtcgatgggccgtccgctgccgggcgtgcccacggtcctggtcgacccggtgagc
ggccagcgctccagcactgagggagagctgtgcctcgatctggccgcgcacccgctcgcg
ctaatgaccagttaccgtggcgaccccgaacgcaacgcggaagtactggccggcggctac
taccacaccggtgacgtcgcatccctcgacgaggacggctacctcacctacatcggccgt
accgacgacgtgttcaaggcctcggactacaaggtgtcccccttcgaactggaaagcgtc
ctcgtcgaacacccggctgtgctcgaggcagccgtcgtgcccgcacccgacgaggtacgc
ctggccgtgccgaaggcctacatcgcacttgctccgggatgggagccgaaccgcgagaca
gcggaggcgatcctccgtcacgcccgcgaaaaccttgccccctacctgcgcgtccggcgg
ctggagttctacgacctacccaaaacgatctccggcaagatccggcgcgtcgagctgcgc
agcagggagagcgaagccgcgggcacccgcctcagcatggagtaccgcgacaccgacttt
cccaggctgaccagccgtaaggccgactga

DBGET integrated database retrieval system