KEGG   Frankia casuarinae: Francci3_4102
Entry
Francci3_4102     CDS       T00320                                 

Definition
(GenBank) Acyl-CoA dehydrogenase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
fra  Frankia casuarinae
Pathway
fra01057  Biosynthesis of type II polyketide products
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Francci3_4102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:fra01008]
    Francci3_4102
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     Francci3_4102
Polyketide biosynthesis proteins [BR:fra01008]
 Polyketide tailoring proteins
  Oxygenase
   Francci3_4102
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: ABD13450
RhizoBase: Francci3_4102
UniProt: Q2J5J2
Position
complement(4909748..4910893)
AA seq 381 aa
MKLTTAGSTLQAAAEVAAVSAAKHVREAETDRRLPRASIDSVLAAGFARHFVPTRYGGDS
GTFGALLPAVATIGASCASTAWVASLIAAAARMAAYLPEAGRAAVWAGGPDALIVAGLMP
GGEAAAGGDSWRLNGQWPYVSGVDHSDWALVCARAVRDGRDEYRFFAVPRPAYRIEPTWF
NVGMRATGSNTLVLDDVRVPASHSVSLRVLADGPAPGEDAPCHQVPMKAANGLTLTGPLL
GAARGALHRWWSLIGPKLQRPGPAISGPVDRLAYDMVLARSGGEIDTAGLLLERVAQVLD
EGAVTPYEESRNGRDCALAAEYLSAAVDRLMRGSGSRGQADGEDLGRFWRDVVCGAGHSG
LQFAARAGGFARHAAEAVNDR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaagctgaccacggccggttccactctgcaggcggcggcggaggtggcggcggtgtcg
gccgccaagcacgtgcgtgaggcggagaccgaccggcgactcccgcgtgcgtcgatcgac
tccgtgctcgccgcggggttcgcccggcacttcgtgcccacgcggtacgggggggacagt
ggcaccttcggtgctctgctgcccgccgtggccaccatcggcgcgtcctgcgcctcgacg
gcctgggtggcgtcactgatcgccgcggccgcccggatggcagcctatcttccggaagcg
ggccgcgctgccgtctgggccggcggcccggacgccttgatcgtcgcggggctgatgccc
gggggagaggcggctgcggggggcgactcgtggcggctcaacgggcagtggccgtacgtg
agcggcgtcgaccactcggactgggccctggtgtgcgcccgggcggtccgtgacggccgg
gacgagtaccggttcttcgcggtgccgcggccggcgtaccggatcgaaccgacgtggttc
aacgtgggcatgcgtgccaccggcagcaacacgctcgttcttgacgacgtgcgggttccg
gcgtcccactcggtgtccctgcgggtgctcgccgacgggccagctcccggggaggacgcg
ccctgccatcaggtaccgatgaaggcggccaacggccttactctcaccggtccactgctc
ggggcggcccgcggcgccctgcaccggtggtggtcgctgatcggaccgaagttgcagcgg
cccggcccggccatatccggcccggtggaccggctggcgtacgacatggtgctggcccgt
tccggcggggagatcgacacggcgggcctgctcctggaacgggtggcgcaggtgctcgac
gagggcgcggtgacgccctacgaggagtcccgtaacggtcgggactgcgcgctggccgcg
gagtatctctccgctgcggtggaccggctgatgcgtggctcgggtagccgagggcaggcc
gacggcgaggatctcggacggttctggcgggacgtcgtctgcggggcgggccacagcggt
ctccagttcgccgcgcgggcgggtggcttcgcccgccatgcggcggaggcggtgaacgac
aggtga

DBGET integrated database retrieval system