KEGG   Frankia casuarinae: Francci3_4190Help
Entry
Francci3_4190     CDS       T00320                                 

Definition
(GenBank) hypothetical protein
Organism
fra  Frankia casuarinae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4096
Motif
Other DBs
NCBI-ProteinID: ABD13538
RhizoBase: Francci3_4190
UniProt: Q2J570
Position
complement(5001584..5002000)
Genome map
AA seq 138 aa AA seqDB search
MTRGDLTDGEWELIEPYLPLGASGLIPDLRSYVNAVMWRFRTGSPWRDVPERYGSWSTIY
DRFRLWAQDGVFQTLMDAMITEAAARDDVDLSLASVDSTVARAHHHAAGMVVDPDLLVDL
EKALTEEKGLQKPGKTTV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtggcgacctgaccgacggtgagtgggagctgatcgagccgtacctcccgctg
ggggcctccgggctgatccctgacctgcgcagctacgtcaacgcggtgatgtggaggttc
cggaccggcagtccctggcgggacgtgcccgaacgctacggctcctggtcgacgatctac
gaccggttccggctgtgggcgcaggacggggtcttccagaccctcatggacgcgatgatc
accgaggcggcggcgcgcgacgatgtcgatctcagcctggccagcgtggactccaccgtc
gcccgcgcgcatcaccacgcggcgggcatggtggtcgacccggatctcctggtcgacctg
gagaaggccctgacggaggaaaaggggcttcagaaaccgggcaaaacgactgtgtga

DBGET integrated database retrieval system