KEGG   Francisella sp. CA97-1460: KX01_1086Help
Entry
KX01_1086         CDS       T05636                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
frc  Francisella sp. CA97-1460
Pathway
frc00730  Thiamine metabolism
frc01100  Metabolic pathways
frc04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:frc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KX01_1086
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    KX01_1086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:frc03016]
    KX01_1086
   03029 Mitochondrial biogenesis [BR:frc03029]
    KX01_1086
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:frc02048]
    KX01_1086
Enzymes [BR:frc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     KX01_1086
Transfer RNA biogenesis [BR:frc03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    KX01_1086
 Prokaryotic Type
    KX01_1086
Mitochondrial biogenesis [BR:frc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    KX01_1086
Prokaryotic defense system [BR:frc02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   KX01_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APC97451
UniProt: A0A1J0KUT6
Position
1097092..1098270
Genome map
AA seq 392 aa AA seqDB search
MKNIYFDYAATTPLSEKVKEEMVNNILSNIDFGNSGSVTHEFGELANKNIESARKIIADT
LGVLPREIIFTSGATESNNLAIKGVLESYQNRGNHIITSKIEHKAVLEVCQYLETRGCYV
TYLEVDNKGNISLDDLENAITEQTVLISLMAVNNELGVKNDLAKIGKIAKRNNILFHVDA
AQGYGKIDINIKEMNINLLSVSGHKIYGPKGIGFLYVSSKSPKVKLQKQIHGGAQEFSKR
AGTLANHQILGLSIAAEEIFINKQENTDHIRNLRDVFLKELNKEHYIKINTDLNNSYEGI
LNITFELIKGETLLAMLNEFALSMGSACTSSSIEPSHVLTAIGLTAEEADSSLRVSFGTM
TTVDDVKSLAKVINHKVKLLRSLLPNKDYADV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatatttattttgactatgctgctacaacacctctttctgaaaaagtaaaggag
gaaatggttaataatattctttcaaatattgattttggtaattctggctcagtaacacat
gaatttggtgaattagctaataagaatatagaatctgctcgtaaaataattgcggatact
ctaggagttttaccaagagagataatatttacatcgggagcgactgaatctaacaatttg
gctatcaagggagtattagaaagttatcagaatagaggtaatcatataattacttcaaaa
atagaacataaagccgttttagaagtttgtcagtatttagagactagaggatgttatgtt
acttatttagaggttgataataaaggtaatataagtttagatgatttagaaaatgcaata
actgaacaaacggtattgattagtttaatggctgttaataatgagctaggtgttaaaaat
gatttagctaaaattggcaagattgcgaaaagaaataatattttatttcatgttgatgct
gctcaaggatatggaaaaatagatataaatattaaagagatgaatattaatttgctatct
gtatcaggacataaaatatatggaccaaagggcataggttttttatatgtaagctctaag
tcacctaaagtaaaattacaaaaacaaattcatggcggagctcaagaattttcaaaaaga
gcaggtactttagcaaatcatcagattctgggcttaagtatcgcggctgaagaaattttc
ataaataaacaagaaaatacagatcacataagaaatcttagagatgtttttcttaaagaa
ttaaataaagagcactatataaagataaatacagatttaaataatagttatgagggaata
cttaatataacttttgagttaattaaaggagaaactttattggcgatgttaaatgaattt
gctttatctatgggctctgcatgcacttcaagttcaatagagccatctcatgttcttaca
gctattggcttaacagctgaagaagctgactctagtttaagagtttcttttggaactatg
acaacagttgatgatgtaaaaagcttagctaaagtgattaatcataaagttaaactttta
aggtctttattgccaaataaggactatgctgatgtataa

DBGET integrated database retrieval system