KEGG   Francisella sp. CA97-1460: KX01_1706Help
Entry
KX01_1706         CDS       T05636                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
frc  Francisella sp. CA97-1460
Pathway
frc00471  D-Glutamine and D-glutamate metabolism
frc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KX01_1706 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:frc01011]
    KX01_1706 (murI)
Enzymes [BR:frc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     KX01_1706 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:frc01011]
 Precursor biosynthesis
  Racemase
   KX01_1706 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: APC96387
UniProt: A0A1J0KRR8
Position
complement(1684457..1685254)
Genome map
AA seq 265 aa AA seqDB search
MNNRPIGVFDSGIGGLTVVKNLMELLPNENIIYFGDIARIPYGTKSRATIQRFAEQTVKF
LLDQEVKAIIIACNTISAVAKEAVQNLAKNIPVIDVISAGAKAAESYNHIGVIATQATVN
SKAYSRAIHEHNKDAVVDSQECGLFVPMIEEGFVKGVAIEAVASEYLSFFKDKDIEALIL
GCTHYPLIADIIAKFIKEGTLLIDPATQACLMLKECLEEKDLLNVTNQKSDYRFYVTDIP
IKFKAMGEMFLKTQMDYLEIVSLEN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaataataggcctataggagtgtttgattcaggtataggaggtctaacggttgttaaa
aacctaatggaactcttaccaaatgaaaatataatttattttggtgatatagctagaatt
ccttatggtactaaatctagggcaactatccagcgatttgctgaacagacagttaaattt
ctattagatcaagaagttaaagcaattattatagcgtgtaatactatttctgcagtagct
aaagaggctgttcagaatttggctaagaatataccagtaatagatgtcataagtgcagga
gcaaaagctgctgaaagctataatcatattggtgtgatagcaacacaagcgacagtcaat
agtaaggcatattcacgagctatacatgagcataataaagatgctgttgttgactcacaa
gaatgtggtctttttgtaccgatgatagaagaaggctttgtaaaaggtgtagcaatagag
gctgtagctagtgaatatctaagtttttttaaagataaggatattgaagctttaatactg
ggatgtactcattatccattaatagcagatataattgcaaagttcattaaagagggtact
ttacttattgatccagcaactcaagcttgcttaatgttaaaagaatgtcttgaggagaaa
gatctattgaatgtaacaaatcaaaaatcagattatagattttacgttacagatattcct
attaaatttaaagcaatgggtgaaatgttcttaaaaacgcaaatggattatttagaaata
gttagtcttgaaaattag

DBGET integrated database retrieval system