KEGG   Francisella sp. CA97-1460: KX01_541Help
Entry
KX01_541          CDS       T05636                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
frc  Francisella sp. CA97-1460
Pathway
frc00430  Taurine and hypotaurine metabolism
frc00620  Pyruvate metabolism
frc00640  Propanoate metabolism
frc00680  Methane metabolism
frc01100  Metabolic pathways
frc01120  Microbial metabolism in diverse environments
frc01200  Carbon metabolism
Module
frc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:frc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KX01_541 (ackA)
   00640 Propanoate metabolism
    KX01_541 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    KX01_541 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KX01_541 (ackA)
Enzymes [BR:frc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     KX01_541 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK CCB1
Motif
Other DBs
NCBI-ProteinID: APC96946
UniProt: A0A1J0KTC1
Position
518729..519886
Genome map
AA seq 385 aa AA seqDB search
MSNVLVLNCGSSSVKFALINPLKNQTAFSGLAENISQKNCKVSFKANKKIEIAIENGKYE
DVFSQIKAYMQDNGYLSTVSAVGHRVVHGGQYFDSSVLITENVIEKIKKCITLAPLHNPA
NVDGIEYCERIFPKLPQVAVFDTAFHQTIEKYVAEYAIPRELTDKYHIRKYGFHGTSHNY
VSKQAAKLLNKERGNFIVAHLGNGCSLSAIVDGKSVDTSMGFTPLDGLIMGTRSGSIDAG
IFSFLAKNLGWNVEKISSVLNKESGLLGICGHNDMREIRELAAKGHTDASLAIKMFSQRV
AKFVASYMIYFDTLDALVFTGGIGENANTIRKNIVDKLSNIGFEIDSAKNDAKDQIYINS
DRSHKIMVVPTNEELMIAKDTLQLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtgttagtattaaactgtggtagttcttcagttaaatttgcccttataaat
cctttgaaaaatcagacagcttttagtgggttggctgaaaatatttctcaaaaaaattgt
aaagttagctttaaagcaaataaaaaaattgagattgctatagaaaatggtaaatatgag
gatgttttttcacaaataaaagcttatatgcaagataatggttatttaagtactgtttcg
gctgttggacatagagttgtacatggtgggcaatattttgatagttctgtgttaattacg
gaaaatgttattgaaaaaattaagaaatgtattactctagcacctttacacaatccagca
aatgtggatggtatagaatattgtgagagaatttttccaaaactacctcaagttgctgta
tttgatacagcatttcatcaaactatagagaaatatgttgcagagtatgcaattcccaga
gaattaactgataagtatcatataagaaagtatggttttcatggtacttcacataactat
gtttctaaacaagcagcaaagcttttaaataaagagagaggaaattttatagttgctcat
ctaggtaatggatgtagcttatctgctattgttgatgggaaaagtgtagatactagtatg
gggtttacccctctagatggtcttataatgggaactcgttcgggttcaatagatgctgga
atatttagttttttagcaaaaaatcttggctggaatgttgagaaaatttctagtgtttta
aataaagaaagtggtttgttaggtatatgtggtcataatgatatgagagaaattcgtgag
ttagcggcaaaggggcatactgatgctagccttgctattaaaatgttctctcaaagagta
gccaagtttgtcgcaagttatatgatttattttgatactttagatgcattagtctttaca
ggcggtataggtgaaaacgctaatacaattagaaagaacatagttgataaactatcaaat
attggatttgagatagattctgctaaaaatgatgctaaagatcaaatttatataaatagt
gatagaagtcataaaataatggttgtgccaactaatgaggagttgatgatagcaaaagat
acattgcaattagtttaa

DBGET integrated database retrieval system