KEGG   Frankia sp. EAN1pec: Franean1_0688Help
Entry
Franean1_0688     CDS       T00608                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00040  Pentose and glucuronate interconversions
fre00052  Galactose metabolism
fre00500  Starch and sucrose metabolism
fre00520  Amino sugar and nucleotide sugar metabolism
fre01100  Metabolic pathways
fre01130  Biosynthesis of antibiotics
Module
fre_M00362  Nucleotide sugar biosynthesis, prokaryotes
fre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Franean1_0688
   00052 Galactose metabolism
    Franean1_0688
   00500 Starch and sucrose metabolism
    Franean1_0688
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_0688
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Franean1_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABW10147
RhizoBase: Franean1_0688
UniProt: A8KZR3
Position
807092..808096
Genome map
AA seq 334 aa AA seqDB search
MPVTKAVIPAAGLGTRFLPATKSVPKEMLPVVDRPAIEYVVEEASRAGLRDVLLVTSRTK
KAIEDHFDREGDVEAALERKGDKVRLERVRASAELAEVHSVRQPSPRGLGHAVLCASAHV
GDEPFAVLLGDDLIDERDPLLVEMLAVQERHGGAVVALMEVPEEAVSMYGVATIAPTAAA
PASAAPASAVSAVSAASVERVSAGGSGGRYRTVRITDLVEKPPVDEAPSNLAVIGRYVLP
AEIFDVLRATPPGRGDEIQLTDALRTLAERAGADPGAEIPVHGVVFTGRRYDTGDRVDYL
KAVVRLACERPDLGPEFYPWLEEYVASGGPKAEC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgaaggcggtcattcccgccgcgggtctggggacccggttcctgcccgcg
acgaagtcggttccgaaggagatgctacctgtcgtcgacaggccggccatcgaatacgtc
gtcgaagaggcctcccgcgcgggcctgcgtgatgtgctgctcgtgacgagccgcaccaag
aaggccatcgaggaccacttcgaccgggagggggatgtcgaggccgcgcttgagcgcaag
ggcgacaaggttcgcctcgaacgcgtccgggcctccgccgagctggccgaggtccactcc
gtccgtcagccctcgccgcgggggctcggtcacgccgttctgtgcgcctccgcgcacgtg
ggcgacgagccgttcgcggtcctgctcggggacgatctcatcgacgagcgtgacccgctg
ctggtcgagatgctcgccgtccaggagcggcacggcggggcggtcgtcgcgctgatggag
gtgcccgaggaggccgtctccatgtacggcgtggcgacgatcgctccgacggccgctgct
cccgcctcggctgctcccgcctcggcggtctcggcggtctcggcggcttcggtggagcgg
gtctcggcgggcgggtccggcgggcgctaccggacggtgcgcatcaccgacctggtcgag
aagccgccggtggacgaggcgcccagcaacctggctgtcatcgggcgctacgtgctgcct
gcggagatcttcgacgtcctgcgggccacgccgcccggccggggggacgagatccagctg
accgacgcgctgcggacgctggcggagcgggccggcgccgatccgggcgcggagattccg
gtgcacggcgtcgtgttcaccgggcgccgttatgacaccggtgaccgggtcgactacctc
aaggcggtcgtccggctcgcctgcgagcggccggacctcggcccggagttctacccgtgg
ctggaggagtacgtggcgtccggcggtcccaaggccgaatgctga

DBGET integrated database retrieval system