KEGG   Frankia sp. EAN1pec: Franean1_1252Help
Entry
Franean1_1252     CDS       T00608                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00520  Amino sugar and nucleotide sugar metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
Module
fre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_1252
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_1252
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Franean1_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABW10706
RhizoBase: Franean1_1252
UniProt: A8L7Q1
Position
complement(1509175..1510020)
Genome map
AA seq 281 aa AA seqDB search
MREDGAMRVFGVDIGGTGIKGAPVDIEDGTLAAPRFRLPTPQPADPESVARTVAEVVAHF
EWTGPVGATFPAVIKSGVARTAANVDEAWIDTDVSAVLGGALGPALAGSEVAVVNDADAA
GVAEMAFGAGRDTSGLVVMTTFGTGIGTALFLHGQLVPNTELGHLEIQGHDAETRASEAV
REREDLSWEKWAKRVNRYLSTLEALLWPDLIIIGGGASRKAEKFFDHLELRTKVVPAQLQ
NEAGVVGAALYAGGDQTRARPAPRPARRRGPATRPPGGRRP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggacggcgcaatgcgggtcttcggggtcgacatcggtgggacgggcatcaag
ggcgccccggtcgacatcgaggatggcacgctggctgcgccgcggttccggctcccgacg
ccgcagcccgcggacccggagtcggtcgcgcggaccgtcgcggaggtcgtcgcgcacttc
gagtggacgggcccggtcggcgccacgttcccggcggtgatcaagtccggggtcgcccgc
accgccgcgaacgtcgacgaggcctggatcgacaccgacgtctccgcggtgctcggcggg
gcactcgggccggcgctggccggctcggaggtcgccgtcgtcaacgacgccgacgccgcc
ggggtggccgagatggcgttcggcgccggccgtgacacctccggcctcgtcgtcatgacg
acgttcggcaccgggatcgggacggcgctgttcctgcacggccagctcgtaccgaacacc
gagctggggcacctggagatccaaggccacgacgcggagacgcgggcgtccgaggccgtc
cgggagcgtgaggatctctcctgggagaagtgggccaagcgggtcaaccgctacctgagc
accctcgaggccctgttgtggccggatctgatcatcatcggcggcggcgccagccggaag
gcggagaagttcttcgaccacctcgaactgcgcacgaaggtggtgcccgcccagctccag
aacgaggcgggcgtcgtcggggcggcgctgtacgccggcggtgaccagacccgcgcccgg
cccgcaccgcgcccggcgcgccggcgcgggccggcgacccggccgcccggcggccgtcgc
ccctga

DBGET integrated database retrieval system