KEGG   Frankia sp. EAN1pec: Franean1_1779Help
Entry
Franean1_1779     CDS       T00608                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00020  Citrate cycle (TCA cycle)
fre00310  Lysine degradation
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
Module
fre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_1779
  Amino acid metabolism
   00310 Lysine degradation
    Franean1_1779
Enzymes [BR:fre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Franean1_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABW11217
RhizoBase: Franean1_1779
UniProt: A8LE82
Position
complement(2137072..2138520)
Genome map
AA seq 482 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKKEGERVEADEPLLEVSTDKVDTEIPAPASGVLGSIK
VAEDETVEVGVELAVIEDGAAGAGAAAAPAEAPAAAPEPPPAPAAAAPPPPPAPPAPSAP
APAPAAAPPPPPAPATPVPAQAPVAAPDAAADGLGRYVTPLVRKMAAELGVDLGSVTGSG
PGGRITKQDIQDAAKSRGSAPAAAPSAPAAPAVPAAPAPAQAPAAPAAARPAPAAAPTAS
TAPRGRTEKLTRLRSLVARRMVESLQVSAQLTTVVEADVTRIAKLRERAKANFQAREGVK
LSFLPFFAVAACEALREHPGINSSIDLEAGTVTYHDSENLGIAVDTDRGLVVPVIHNASD
LNLSGMARKIDELAARTRANQVSPDDLGGGTFTLTNTGSRGALFDTPIINQPQVAILGTG
SVVKRPAVVTDPELGEVIAIRSKVYLALTYDHRIVDGADAARFLTAIASRLEEGAFEAEL
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatccgtcacgatgccccgcctcggggagagcgtctccgaggggacggtcacc
cgctggctgaagaaggaaggcgagcgggtcgaggccgacgagccgctcctcgaggtcagc
accgacaaggtcgacaccgagatccccgcgccggcctccggcgtgctcggctcgatcaag
gtcgccgaggacgagaccgtcgaggtcggcgtcgagctggctgtcatcgaggacggcgcc
gcgggtgccggcgcggcggccgcgcccgccgaggcccccgccgcggccccggagcctccg
ccggcgcctgccgccgccgcgccgcccccgccgcctgctccccccgctccgtcggcgccg
gcgcccgctcccgcggcggcaccgcctccgccgccggctcccgccacgccggtgcccgcg
caggccccggtcgccgccccggacgccgccgccgacggtctcggccggtacgtgacgccg
ctggtccgcaagatggccgcggagctgggcgtcgacctcggctcggtcaccggcagcggc
ccgggtggacgcatcaccaagcaggacatccaggacgcggcgaagtcccgcggctccgcg
ccggccgcggctcccagcgcccccgccgctccggctgtgccggccgctcccgccccggcg
caggcccccgcggcgcccgcggccgcccggccggctcccgccgccgcgccgaccgcgtcc
accgcgccccgtggccgcaccgagaagctgacccggctgcgctcgctggtcgcccgtcgg
atggtcgagtcgctgcaggtcagcgcgcagctcaccaccgtcgtggaggccgacgtcacg
cggatcgcgaagctgcgcgagcgggccaaggcgaacttccaggcccgcgagggcgtgaag
ctgtcgttcctgccgttcttcgcggtggccgcgtgcgaggcactgcgcgagcacccgggg
atcaactccagcatcgacctggaggcgggcacggtcacctaccacgactcggagaacctc
ggcatcgccgtcgacaccgaccgtggcctggtcgtcccggtgatccacaacgccagcgac
ctgaacctcagcgggatggcccgcaagatcgacgagctggccgcgcggacccgcgccaac
caggtgtccccggacgacctgggcggtggcaccttcacgctgaccaacaccggcagccgc
ggcgccctgttcgacaccccgatcatcaaccagccgcaggtggcgatcctgggcaccggg
tcggtcgtgaagcgcccggccgtcgtcaccgatcccgagctcggcgaggtgatcgccatc
cggtcgaaggtctacctggccctcacctacgaccaccggatcgtggatggcgccgacgcg
gcccggttcctcaccgcgatcgccagccgtctcgaggaaggcgccttcgaggccgagctc
gggctgtag

DBGET integrated database retrieval system