KEGG   Frankia sp. EAN1pec: Franean1_1931Help
Entry
Franean1_1931     CDS       T00608                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01130  Biosynthesis of antibiotics
fre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Franean1_1931
Enzymes [BR:fre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Franean1_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE
Motif
Other DBs
NCBI-ProteinID: ABW11368
RhizoBase: Franean1_1931
UniProt: A8LGR8
Position
2313797..2314603
Genome map
AA seq 268 aa AA seqDB search
MNALEEILDGVRADLAVRERETSLAALKQRVERVPDPRDALAVLRAPRVSVIAEIKRRSP
SRGALATIADPAALASLYEQAGAAAVSVLTEQRRFGGSLADLDAVRVAVDIPVLRKDFVI
SPYQVLEARAHGADMVLLIVAALDQPRLIGLLERVESLGMTALVEVHDETEMLRALDAGA
RLVGVNARNLRTLEVDRETFARLAPMVPQGVLKVAESGVRGPRDLLQYAGAGADAVLVGE
AAVTGGDPRQFVADLVTAGTHPATRIAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgaggagatcctcgacggggtcagagcagatctggccgtccgtgagcgg
gaaacgtccctggcagctctgaaacaacgtgttgagcgtgtacccgatccccgggacgcg
ctggcggtgctgcgcgcaccgcgggtttcggtgatcgcggagatcaagcgccgctcgccg
tccaggggtgcgctcgcgacgatcgccgatccggcggcgctcgcctcgctctacgagcag
gcgggcgccgcggcggtcagcgtcctcaccgagcagcggcggttcggcggctcgctggcc
gatctggacgccgtccgggtggccgtcgacatccccgtcctgcgcaaggacttcgtgatc
tcgccgtaccaggtcctcgaggcgcgggcgcatggcgccgacatggtcctgctgatcgtg
gccgcactcgatcagccgaggctgatcgggctgctcgagcgggtcgagtcgctgggcatg
accgcgctggtcgaggtgcacgacgagaccgagatgctgcgggcgctcgacgcgggcgcc
cggctggtcggggtcaacgcccgcaacctgcgcaccctcgaggtggacagggagaccttc
gcccggctcgcgccgatggtcccgcagggggtgctgaaggtcgccgagtccggcgtgcgc
ggcccgcgcgacctgctccagtacgcgggtgccggggcggacgcggtgctggtcggggag
gccgccgtgaccggcggcgacccgcgccagttcgtcgccgatctcgtgaccgctggaacg
catcccgccacccgtatcgcgcactga

DBGET integrated database retrieval system