KEGG   Frankia sp. EAN1pec: Franean1_2426Help
Entry
Franean1_2426     CDS       T00608                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00030  Pentose phosphate pathway
fre00051  Fructose and mannose metabolism
fre00052  Galactose metabolism
fre00680  Methane metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
fre01230  Biosynthesis of amino acids
fre03018  RNA degradation
Module
fre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_2426
   00030 Pentose phosphate pathway
    Franean1_2426
   00051 Fructose and mannose metabolism
    Franean1_2426
   00052 Galactose metabolism
    Franean1_2426
  Energy metabolism
   00680 Methane metabolism
    Franean1_2426
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Franean1_2426
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Franean1_2426
Protein phosphatases and associated proteins [BR:fre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Franean1_2426
Messenger RNA biogenesis [BR:fre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Franean1_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABW11858
RhizoBase: Franean1_2426
UniProt: A8L443
Position
2887303..2888640
Genome map
AA seq 445 aa AA seqDB search
MDEPLTVDGAELDVRKLGPCRIDSPLLPLLGARPTTQHYIDEGDKVLFDDTVSMISARKV
PLDELPGFEPAGPRRKIYFDPSKTRVGIVTCGGLCPGLNNVIRGLVLELTNHYGVNRIFG
FRHGYQGFIAKYGHSVVDLTPERVANIDEDGGTILGTSRGQQDPAEIVDCLSRMNINILF
VIGGDGTLRGARAIAGIVAERGEKIAVVGIPKTIDNDIPYIDQSFGFQTAFAKAAESIRA
AYAEATSAPGGVGIVRLMGRHSGFIACYAVLAKSDADVVLIPELPFTLEGERGLLAYIRQ
RVEKRGHAVVVVAEGAGQDLVAGLPESSDASGNRKLYDIGPELSRRITEDFAARGAELNL
KYIDPSYHIRSVAANPYDNVYTIRLAHAAVHAAMSGRTEMVVGRWRRRFIHIPIALAVSQ
RNQVDPAGDLWMSVLEATGQPYRFG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagccgctgaccgtcgacggcgccgagttggatgtccgcaagctcggcccgtgc
cggatcgactcgccgctgctcccgttgctcggtgcgcggccgacgacccagcactacatc
gacgagggcgacaaggtcctcttcgacgacaccgtttcgatgatctccgcgcggaaggtg
ccgctggacgagctgccgggcttcgagcccgccgggccgcgccgcaagatctactttgac
ccgtccaagacccgggtggggatcgtgacctgcggggggctctgccccggcctgaacaac
gtcatccgcgggctggtgctcgagctgaccaaccactacggcgtgaaccggatcttcggg
ttccggcacggctaccagggtttcatcgccaagtacgggcacagcgtcgtcgacctcacc
ccggagcgggtggcgaacatcgacgaggacggcggcacgatcctcggcacctcccgcggc
caacaggacccggcagagatcgtcgactgcctttcccggatgaacatcaacatcctgttc
gtgatcggcggtgacggcacgctgcgcggtgcgcgggcgatcgccggcatcgtcgccgag
cgcggggagaagatcgcggtcgtcggcatcccgaagacgatcgacaacgacatcccctac
atcgaccagagcttcgggttccagaccgcgttcgcgaaggccgccgagtcgatccgcgcc
gcgtacgccgaggcgacctcggctcccggcggggtcggtattgtccggctgatgggccgc
cactccggcttcatcgcctgttacgcggtgctggccaagagcgatgcggacgtcgtgctc
atcccggagctgcccttcaccctggagggggagcggggcctgctcgcctacatccgtcag
cgggtcgagaagcggggccatgccgtcgtcgtcgtggcggagggcgccgggcaggacctg
gtcgccggcctgcccgagtcgtccgacgcctcggggaaccgcaagctctacgacatcggc
ccggagctctcccggcggatcaccgaggatttcgccgcccgcggcgccgagctcaacttg
aagtacatcgacccgagctaccacatccgcagcgtggcggcgaacccgtacgacaacgtc
tacacgatccggctggcgcacgcggcggtccacgccgcgatgtccgggcgcacggagatg
gtcgtcgggcgctggcgccgccggttcatccacatcccgatcgcgcttgccgtcagccag
cgcaaccaggtcgacccggccggtgatctgtggatgtcggtcctggaggccaccggccag
ccctaccgcttcggctga

DBGET integrated database retrieval system