KEGG   Frankia sp. EAN1pec: Franean1_2625Help
Entry
Franean1_2625     CDS       T00608                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00790  Folate biosynthesis
fre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Franean1_2625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fre04147]
    Franean1_2625
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Franean1_2625
Exosome [BR:fre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Franean1_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABW12055
RhizoBase: Franean1_2625
UniProt: A8L6R8
Position
complement(3106730..3107029)
Genome map
AA seq 99 aa AA seqDB search
MAEALTREQIEKHLKTLDGWTTDGRRIERLYSIPHVQGAAFVMHIAVIQNEFGHHSDATL
GYKTVHVSISSSDIGGYVAEHDIELAKRIQAIASAHGTG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcactgacacgggaacagatcgagaaacacctcaagaccctggacggatgg
acgaccgacggccgacgcatcgaacggctgtactcgataccccatgtccagggcgcggcg
ttcgtcatgcacatcgccgtcatccagaacgagttcggccaccactccgatgccacactc
ggctacaagaccgtgcacgtgtcgatcagctccagcgacatcggcggctatgtcgccgag
cacgacatcgagctcgccaagcgtatccaggcgatcgcatcagcgcatggaacggggtaa

DBGET integrated database retrieval system