KEGG   Frankia sp. EAN1pec: Franean1_3699Help
Entry
Franean1_3699     CDS       T00608                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00053  Ascorbate and aldarate metabolism
fre00071  Fatty acid degradation
fre00280  Valine, leucine and isoleucine degradation
fre00310  Lysine degradation
fre00330  Arginine and proline metabolism
fre00340  Histidine metabolism
fre00380  Tryptophan metabolism
fre00410  beta-Alanine metabolism
fre00561  Glycerolipid metabolism
fre00620  Pyruvate metabolism
fre00625  Chloroalkane and chloroalkene degradation
fre00903  Limonene and pinene degradation
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_3699
   00053 Ascorbate and aldarate metabolism
    Franean1_3699
   00620 Pyruvate metabolism
    Franean1_3699
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Franean1_3699
   00561 Glycerolipid metabolism
    Franean1_3699
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Franean1_3699
   00310 Lysine degradation
    Franean1_3699
   00330 Arginine and proline metabolism
    Franean1_3699
   00340 Histidine metabolism
    Franean1_3699
   00380 Tryptophan metabolism
    Franean1_3699
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Franean1_3699
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Franean1_3699
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Franean1_3699
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Franean1_3699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABW13096
RhizoBase: Franean1_3699
UniProt: A8L1M4
Position
4379954..4381369
Genome map
AA seq 471 aa AA seqDB search
MREYLKFYIGGQWAEPAEQRTFDVVNPATEQVAGRVALGSATDVDRAVAAARAAFPSWSA
TSREERIAVLESILDVYQKRAGDLATALTEEMGAPAALANGFQVGLGAGHLTTAIEILKN
FSFEEQRGVTRVVLEPIGVCGLITPWNWPINQIAVKVLPALATGCTVVLKPSEESPFTGQ
ILAEIFEAAGVPAGVFNLVQGDGPSVGVPLSAHPDVDLISFTGSTRAGIEIAKNAAPTVK
RVTQELGGKSPNIVLDDQDFAENVAKGVINMMGNSGQTCTAPARLLVPSARMEEAISAAR
EAAAQVTVGDPNGEFTIGPVASGRQFEKIQGLIQQGIDEGATLVAGGTGRPDGLETGFYV
KPTVFADVTNDMIIGREEIFGPVLTIHGYDSVDHAVELANDTEYGLAGYVAGADLDAARA
VARRIRAGWVAINDGFDFGGPVGGYKKSGNGREWGEFGFHEYLETKGIHGY
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatacttaaagttctacatcggcggccagtgggcggaaccggccgagcagcgg
acctttgatgtcgtgaatccggcgaccgagcaggtcgccggccgggtggcactcggctcc
gccaccgacgtggaccgggcggtcgcggccgcccgggccgccttccccagctggtcggcg
accagccgcgaggagcggatcgcggtcctcgagagcatcctcgacgtctaccagaagcgt
gccggcgacctcgccaccgcgctgaccgaggagatgggcgcgccggccgcgctggccaac
ggcttccaggtcggcctcggcgccgggcacctgaccactgcgatcgagatcctcaagaac
ttctccttcgaggagcagcgcggggtcacccgcgtggtcctcgagccgatcggggtctgc
ggcctgatcacgccgtggaactggccgatcaaccagatcgcggtcaaggtccttcccgcg
ctcgccacgggctgcaccgtggtgctcaagccgtccgaggagtcgcccttcaccgggcag
atcctcgccgagatcttcgaggcggccggggtccccgccggcgtgttcaacctggtccag
ggcgacggccccagcgtgggcgtgccgctgtcggcgcatcccgacgtggacctgatctcg
ttcaccggctccacccgcgcgggcatcgagatcgccaagaacgccgcgcccacggtgaag
cgggtgacccaggagctgggcggcaagagcccgaacatcgtcctcgacgaccaggacttc
gccgagaacgtcgccaagggcgtcatcaacatgatgggcaactccgggcagacctgcacg
gcgcccgcccgcctgctggtgcccagcgcccggatggaagaggcgatcagcgccgcccgc
gaggccgcggcgcaggtgaccgtgggcgatcccaacggcgagttcacgatcgggccggtg
gcctccgggcgccagttcgagaagatccagggcctgatccagcagggcatcgacgagggc
gccacgctggtcgccggcgggaccggtcgaccggacgggctggagacgggcttctacgtc
aagcccaccgtcttcgccgacgtcacgaacgacatgatcattggccgggaggagatcttc
gggccggtgctcacgattcacggctacgacagcgtggatcacgccgtcgagctcgcgaac
gataccgagtacggcctcgccggctatgtggccggcgcggacctcgatgcggcgcgcgcc
gtcgcccggcggatccgggccgggtgggtcgcgatcaacgacgggttcgacttcggtggt
ccggtcggcggctacaagaagagcgggaacgggcgcgagtggggcgagttcggtttccac
gagtacctggagaccaagggcatccacggctactag

DBGET integrated database retrieval system