KEGG   Frankia sp. EAN1pec: Franean1_3841Help
Entry
Franean1_3841     CDS       T00608                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Franean1_3841
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Franean1_3841
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Franean1_3841
    1.1.1.-  
     Franean1_3841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Sacchrp_dh_NADP Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABW13233
RhizoBase: Franean1_3841
UniProt: A8L340
Position
4563231..4564283
Genome map
AA seq 350 aa AA seqDB search
MIAARLHGPGDLRVEEVDEPEAAAGEVKIAVAHNGLCGTDLTEIFSGPRACTTVPHPLTG
GVLPQIVGHEFAGVVAAVGAGVTDVAVSERVSVEPLYSCGDCDRCQASLPELCRQVMTHG
ICSNGGGLAQFTTVPRAMVHRLPASMSLAEGALVEPMAVAFNGVLRSGVEAGGSALVFGA
GPIGMGVVFGLRAVGVADILLVEPASARRAAAERLGVADVLDPNTTDVADEVRRRTGGRG
VDVVLDAAGAPGTFGLAPAVLRARGRYVGIAVAERPVEFAPWVLARGEIELTGSLGYGPG
VFTRVIDLIAGGAYPTAGWVDHVGLSDLHDALQDLRDGRRMKVLVDLPAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcgaggttgcacggccccggtgacctgcgcgtcgaggaggtcgacgagccc
gaggcggcggcgggcgaggtgaagatcgctgtggcccacaacgggctgtgtggcaccgac
ctcacggagatcttctccgggccgcgggcctgcacgacggtgccgcatccgctcaccggc
ggtgtgctgccccagatcgtgggccacgagttcgccggggtggtcgcggccgtcggggcg
ggcgtcaccgacgtcgccgtcagcgagcgggtcagcgtggagccgctctactcctgcggt
gactgcgaccgctgccaggccagtctccccgaactgtgccggcaggtcatgacgcacggg
atctgctcgaacggcggcgggctggcccagttcacgaccgtcccgcgggcgatggtgcac
cgccttcccgcgtcgatgtcgctggccgagggcgcgctggtggagccgatggcggtcgcg
ttcaacggcgtgctgcgctccggtgtagaggcgggcggatccgccctcgtgttcggtgcc
gggccgatcgggatgggcgtggtgttcgggctgcgcgccgtcggggtggcggacatcctg
ctcgtcgagccggcgtcggcgcggcgtgccgcggcggagcggctcggtgtcgccgacgtc
ctcgacccgaacacgaccgacgtcgccgacgaggtccggcgccgcaccggcggtcgcggc
gtcgacgtggtgctggacgccgccggggcgcccgggacgttcgggctggccccagccgtg
ctgcgggcccgggggcgctacgtcgggatcgcggtcgccgagcggccggtcgagttcgcg
ccatgggtgctggcccggggggagatcgagctgaccgggtcgctgggctacggccccggg
gtgttcacccgggtgatcgatctgatcgcgggcggcgcgtacccgacggcggggtgggtc
gaccacgtcggcctgtccgacctgcacgacgctctacaagatcttcgcgacggccggcgg
atgaaggtcctcgtcgacctgcctgccggctga

DBGET integrated database retrieval system