KEGG   Frankia sp. EAN1pec: Franean1_4489
Entry
Franean1_4489     CDS       T00608                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00903  Limonene and pinene degradation
fre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Franean1_4489
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Franean1_4489
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: ABW13866
RhizoBase: Franean1_4489
UniProt: A8LBW8
Position
complement(5356385..5357224)
AA seq 279 aa
MAGRVAGKVALITGAARGQGRSHAVRLAQEGADIIAVDLCADVPGVPYPGGTREDLAETV
RQVEALDRRAVATVADVRDHEQLAAAVVGGVAEFGRLDVVSANAGIAMPPFPTHEMPEEV
WQGMLAVNLTGVWHTCKAAIPHLIAGGRGGSIILTSSAAGLRGYENIANYVAAKHGVVGL
MRTLANELARHSIRVNSVHPTTVSTEMIQNESTYRQFRPDLTDTPTEDDVRDAFTSLNLI
PVPWIESIDVSNALLFLASDESRYITGITLPIDAGQMVK
NT seq 840 nt   +upstreamnt  +downstreamnt
atggccgggcgagtcgccgggaaggtcgcgctgatcaccggggcggcgcgcgggcagggc
cgcagccacgcggttcggctcgcgcaggagggggccgacatcatcgccgtcgacctctgc
gccgacgtgccgggcgtgccgtacccggggggcacccgcgaggatctggccgagacggta
cggcaggtggaggccctcgatcggcgggccgtggcgacggtcgccgacgtgcgtgaccac
gagcagctcgcggcggctgtggtggggggtgtcgccgagttcgggcggctcgacgtggtc
agcgcgaacgcgggcatcgccatgccgcccttccccacccacgagatgcccgaggaggtg
tggcagggcatgcttgcggtcaacctgaccggcgtctggcacacctgcaaggccgccata
ccgcacctgatcgcgggtggccgcggcgggtcgatcatccttacgagttccgcggctggt
ctcaggggttacgagaacatcgccaactacgtcgcggccaagcacggcgtggtcggtctg
atgcggacgctggccaacgagctcgcccggcactcgatccgggtgaattcggtgcatccc
accactgtctcgaccgagatgatccagaacgagtcgacctaccgccagttccggccggac
ctgaccgacacgccgaccgaggacgacgtgcgcgacgcgttcacgtcgctcaatctgata
ccggtgccctggattgagtcgattgacgtgtcgaacgcgctgctgtttctcgcgtccgac
gagtctcggtacatcaccggcatcacgctgccgatcgacgccggccagatggtcaagtag

DBGET integrated database retrieval system