KEGG   Frankia sp. EAN1pec: Franean1_5648Help
Entry
Franean1_5648     CDS       T00608                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00471  D-Glutamine and D-glutamate metabolism
fre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Franean1_5648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fre01011]
    Franean1_5648
Enzymes [BR:fre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Franean1_5648
Peptidoglycan biosynthesis and degradation proteins [BR:fre01011]
 Precursor biosynthesis
  Racemase
   Franean1_5648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABW14999
RhizoBase: Franean1_5648
UniProt: A8L764
Position
6861682..6862512
Genome map
AA seq 276 aa AA seqDB search
MSGAPIGVFDSGVGGLTVARAILDQLPGESLLYIGDTAHAPYGPRPIAEVRRYALAALDE
LVSAGVKLLVIACNSASAACLRDARERYDVPVVEVIVPATRRAVAATRSGRVGVIGTVAT
ITSRAYEDAFAAAAGTELVSVACPAFVDFVERGITSGRQLLGLTEAYLAPLQEADVDTVI
LGCTHYPLLTGVIGLVMGEGVTLVSSAEETAKDTYRVLARDGLFRDPDLPPPAHRFLTTG
DPAAFARVGRRFLGPEITAVSIAPAAAPRQAQAVGR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgcccatcggggtgttcgacagtggagtcggcggtctcaccgttgcgcgc
gcgatcctggaccagctgccaggagagtcgctgctctacatcggcgacaccgcgcacgcc
ccctacgggccgcgaccgattgccgaggtgcgccggtacgccctcgccgcactggacgaa
ctcgtctccgcgggtgtgaaacttcttgtcatcgcgtgcaattccgcgagcgcggcatgc
ctgcgcgatgcccgggaacgctacgacgtaccggtggtcgaggtcatcgtgcccgcgacc
cgccgtgccgtcgcggcaacacggagtggtcgagtgggagtcatcggaacggtcgccacg
atcaccagccgggcctacgaggacgccttcgcggcggccgcgggcaccgagctggtcagc
gtggcgtgcccggccttcgtcgatttcgtcgagcgcggcatcacgtccggccggcagttg
ctgggactcaccgaggcgtatctggcaccgttgcaggaagccgacgtcgacacagtgatt
ctcggatgcacccactatccactgttgaccggcgtcatcggtctcgtcatgggagagggc
gtcacactggtgagcagcgccgaggagacggccaaggacacctaccgggtgctcgcccgc
gacggcctcttccgcgaccccgacctgccgcccccggcgcatcgcttcctgaccaccggt
gatcccgccgcgttcgcgcgggtgggccgccgtttcctgggccccgagatcacggcggtg
agcatcgccccggcggcggccccccggcaggcacaggcggtgggacgatga

DBGET integrated database retrieval system