KEGG   Frankia sp. EAN1pec: Franean1_6202Help
Entry
Franean1_6202     CDS       T00608                                 

Definition
(GenBank) UTP-GlnB uridylyltransferase, GlnD
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Franean1_6202
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     Franean1_6202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT HD GlnD_UR_UTase DUF294 ACT_6 ACT_4 GlnE
Motif
Other DBs
NCBI-ProteinID: ABW15545
RhizoBase: Franean1_6202
UniProt: A8LDN7
Position
complement(7534481..7536919)
Genome map
AA seq 812 aa AA seqDB search
MNDRLQALRGRVDAFPGVTGPALREALVERADAALGELFGEPGPGVALLAVGGYGRSEPA
FGSDLDLVLVHDGRRGDISAVADAIWYPLWDAGVGLDHSVRTVDEAVSVADSDLKAALGL
LDARVIRGDGGLAGTLLERVRTRWRERAPRRLPELAEAVAERARRMGELAFLLEPDLKEA
RGGMRDVHALHALAAAWVAEAPPERVQAAYQVLLDARGEVRRLSHGRAQDRLLLQDGTAV
AAALGYPDSVALSRAISDAGRTISWTWDTTWYRVAAAQRSKIRSRLRRPVRRPLDEGVVE
QDGEIQLARDAEPATDPGLVLRAAAAAARAGVPFGRYAIDRLGREAPAMPEPWPEAARDD
LVSLLATGDAAVRVLESLDQVGLLVRLIPEWAAVRSKPQRNPYHRYTVDRHLIEAAARAA
AHTRDVDRPDLLLLGALLHDIGKGYPGDHTDAGIVIVQTLAPRLGLPPEDTEVLVAMVRH
HLLLTEAATRRDIDDVATIESVAAAAGSVRVLTLLHRLTEADAKATGPTAWNAWKARLVT
DLVDRATAVLDGKAPPCPPALTERQTALLALPDDLTVQVNPLPDEGMFEIVVVTADRVGL
LATTAGVLALNRLDVRRASARGAGGRSLLQAAVASAHGHRPDPKRLRDDLRAALAGTLDV
TARLTGREQDYATTRRWNTPGAPQVIFDDSGSTTVIEVRAPDRAGVLHRITGALAEAGLD
VRTAIVATLGLDVVDAFYVEDSSAPVTAASTASTASSSATISTSATSASVGSVAAASAAS
VTGLAAPRLLGSARRAEVATAVMAALDIGEPG
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacaggctccaggccctgcggggccgggtggacgcttttcccggtgtgaccggg
cccgcgttgcgggaggcgctggtcgagcgcgccgacgcggccctcggggagctgttcggg
gaaccagggcccggagtcgcgctgctcgcggtcggtggctacgggcgaagcgagcccgcc
ttcggcagcgacctggaccttgtgctcgtccacgacggccgccgaggcgacatctccgcc
gtcgccgacgcgatctggtacccgctgtgggacgccggagtcggcctggaccacagcgtc
cgcaccgtggacgaagccgtctccgtcgccgactccgacctcaaggcggcgctcggcctg
ctcgacgcccgcgtgatccgcggcgacggcggcctcgcgggcacgctgctggaacgggtc
cggacccggtggcgggaacgcgcaccgcgccgcctgcccgagctcgccgaggcggtcgcg
gagcgcgcgcgccggatgggcgagctcgccttcctgctcgagcccgacctcaaggaggcc
cggggcggcatgcgggacgtccacgcgctgcacgccctcgccgcggcctgggtcgccgag
gcgccgccggagcgcgtccaggccgcctaccaggtgctgctcgacgcccgcggtgaggtg
cgccggctcagtcacggccgcgcgcaggaccgcctgctcctgcaggacggcacggcggtg
gccgcggcactgggctaccccgactccgtcgcgctgtcccgggccatctcggacgccggc
cgcacgatctcctggacgtgggacacgacctggtaccgggtggccgccgcgcaacgctcg
aagatccgttcccggctgcgccggccggtccgacgtcccctcgacgagggcgtcgtcgaa
caggacggggagatccagctggcccgcgacgccgaacccgccaccgaccccgggctggtg
ctccgggcggccgcggccgcggcacgcgccggcgtcccgttcgggcgctacgccatcgac
cggctcggccgcgaggcgccggcgatgcccgagccgtggcccgaggccgcccgggacgac
ctggtcagcctgctggcgaccggggacgccgcggtgcgggtgctggagtccctcgaccag
gtcgggctgctcgtgcggctgatccccgagtgggcggccgtgcgcagcaagccgcagcgc
aacccctaccaccgctacaccgtcgaccggcacctgatcgaggccgccgcccgcgccgcc
gcccacaccagggacgtcgaccggcccgacctgctgctgctcggcgcgttgctgcacgac
atcggcaagggatacccgggagaccacactgacgccggcatcgtcatcgtccagacgttg
gcgccccggctgggcctgccgcccgaggacaccgaggtgctggtcgcgatggtccgccat
cacctgctgctgaccgaggcggcgacccggcgggacatcgacgacgtcgccaccatcgag
tcggtggcggccgcagccggcagcgtgcgcgtactcaccctgctgcaccggcttaccgaa
gccgacgcgaaggccaccggcccgaccgcgtggaacgcctggaaggcccggctcgtcacc
gacctcgtcgaccgggccaccgccgtgctcgacggcaaggcaccgccgtgcccgccggcg
ctcaccgaacggcagaccgccctgctcgcgctgcccgacgacctcaccgtgcaggtcaac
ccgctccccgacgagggcatgttcgagatcgtggtcgtcaccgccgaccgggtgggcctg
ctcgcgaccaccgccggcgtcctcgcgctcaaccggctggacgtccgccgcgcctccgcg
cggggcgccggcggccgctcgctgctacaggccgccgtcgcgtccgcgcacgggcaccgc
ccggacccgaagcggctgcgcgacgacctgcgcgcggccctggcgggcaccctcgacgtc
accgcccgcctgaccggccgggaacaggactacgccaccacccgtcggtggaacacgccg
ggggcacctcaggtgattttcgacgactccggctcgacgacggtcatcgaggtgcgcgcc
cccgaccgtgccggggtgctgcaccggatcaccggcgcgctggccgaggccggcctggac
gtccgcaccgcgatcgtcgcgaccctcggcctggacgtcgtcgacgccttctacgtcgag
gactcgtcggccccggtcacagctgcctccacggccagcacggccagttcttcggccacc
atctccacgtcggccacctctgcgtctgtcgggtctgtggccgcggcgtccgccgcctcc
gtgaccggcctcgctgccccgcgacttctgggtagcgcgcggcgggccgaggtggcgacc
gccgtcatggccgcgctcgacataggggagcccggctaa

DBGET integrated database retrieval system