KEGG   Frankia sp. EAN1pec: Franean1_6970Help
Entry
Franean1_6970     CDS       T00608                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00620  Pyruvate metabolism
fre00630  Glyoxylate and dicarboxylate metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Franean1_6970
   00630 Glyoxylate and dicarboxylate metabolism
    Franean1_6970
Enzymes [BR:fre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Franean1_6970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABW16303
RhizoBase: Franean1_6970
UniProt: A8L3P3
Position
8494921..8497098
Genome map
AA seq 725 aa AA seqDB search
MPDYIDVVGLRVASELHQFVAEEALPGSGVDQAAFWAGATEIINDLTPRNRELLARRDEL
QQAVDDYHRRTPGRPAQSDYAEFLTSIGYLLDEPAPFTITTDGVDDEIATQAGPQLVVPL
LNARYAVNAANARWGSLYDALYGSDVIDETDGRERAGGYNPTRGAAVIARVREILDRSFP
LTSGSHADATRYAVDADGLVVTVDGAAVRLADPALFVGFRGEGDEPTAVLLTHHGLHVEI
QVDRNHPVGAGDRAGVSDVVVEAAVTTIMDLEDSVAAVDAADKVLGYRNWLQLMQRRLTA
EVDKGGRTFTRVLAADREYTTADGGTVTLPGRSMLLIRQVGLLMTTDAVLDRDGRPVPEG
ILDALVTGLGSVHDLRGDTAGGNSRTGSAYVVKPKMHGPDEVAFTVELMSRVERLLQLPP
ATIKLGIMDEERRTSVNLRRCVYEARDRVVFINTGFLDRTGDEIHTSMLAGPMVRKAAMR
EATWIRVYEDNNVDAGLALGFPGRAQIGKGMWAAPDNLADMMTQKIGHPLAGASCAWVPS
PTAAALHALHYHEVSVADRQRELAGRRPADRLELLTVPLAEPAAAWSPEEVAAEVDNNVQ
GVLGYVVRWVELGIGCSKVPDLTGTPLMEDRATCRISSQHVANWLRHGIVSREQVEESLR
RMAALVDAQNAGEPGYRPMAPAFEELAFAAARALLLEGADQPNGYTEPLLHEHRRAQKNK
EMVRS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgactacatcgacgtcgtcggactgcgcgtcgccagcgagctgcaccagttcgtc
gccgaggaggcgctgcccgggtcgggtgtcgaccaggccgcgttctgggccggcgccacg
gagatcatcaacgatctgaccccgcgcaaccgggagctactggcgcggcgcgacgagctc
cagcaggctgtggacgactaccaccggcgcacgccgggccggccggcgcagagcgactac
gccgagttcctgacctccatcggctacctgctcgacgagcccgcgccgttcaccatcacc
accgacggcgtggacgacgagatcgcgacccaggccggcccgcagctggtggtgccgctg
ctcaacgcgcggtacgcggtcaacgccgccaacgcccggtggggctcgctctacgacgcc
ctgtacggcagcgacgtcatcgacgagacagacggcagggagcgcgccggcggctacaac
ccgacccgcggcgccgcggtcatcgcccgggtccgggagatcctcgaccggagcttcccg
ctgaccagcggctcgcacgcggacgcgacccggtacgcggtcgacgccgacgggctcgtc
gtcaccgtcgacggggccgccgtccggctggccgaccccgcgctgttcgtcggcttccgc
ggcgagggcgacgagccgacggctgtcctgctgacccatcacgggctgcacgtcgagatc
caggtcgaccggaaccacccggtcggggcgggcgaccgcgcgggcgtcagcgacgtcgtc
gtcgaggccgccgtcaccacgatcatggacctggaggactcggtcgcggccgtcgacgcc
gcggacaaggtgctcggctaccgcaactggctgcagctcatgcagcgccggctcaccgcc
gaggtggacaagggcggccgcaccttcacccgggtcctcgccgccgaccgcgagtacacg
accgccgacggcggcacagtcaccctgcccggccggtcgatgttgctcatccgccaggtc
gggctgctgatgaccaccgatgcggtcctcgaccgcgacggccggccggtgcccgagggc
atcctcgacgcgctggtcaccggcctgggcagcgtgcatgacctgcgcggcgacaccgcc
ggcggcaactcccgcaccggctcggcgtacgtggtcaagcccaagatgcacggcccggac
gaggtcgccttcaccgtcgagctgatgtcccgcgtcgagcgcctcctccagctcccgccg
gcgacgatcaagctcggcatcatggacgaggaacgccgcacctcggtcaacctcaggcgc
tgcgtgtacgaggcccgggaccgcgtcgtcttcatcaacaccgggttcctggaccggacc
ggcgacgagatccacacctcgatgctcgccgggccgatggtccgcaaggccgccatgcgc
gaggcgacgtggatccgcgtctacgaggacaacaacgtcgacgccggcctcgccctcggt
ttccccgggcgggcgcagatcggcaagggcatgtgggccgcgccggacaatctggccgac
atgatgacgcagaagatcgggcacccgctggccggcgcgtcctgcgcctgggtgccctcg
cctaccgccgcggcgctgcacgcactgcactaccacgaggtctccgtggcggaccggcag
cgcgagctggccggccgccgcccggccgaccggctggagctgctcaccgtcccgctcgcg
gaaccggcggccgcctggtcgccggaggaggtcgccgccgaggttgacaacaacgtccag
ggcgtgctcggctacgtcgtgcgctgggtcgagctcggcatcggctgctccaaggtgccc
gacctgaccggcacacccctgatggaggaccgcgccacctgccgcatctcctcccagcac
gtggccaactggctgcggcacggcatcgtctcccgcgagcaggtcgaggagtcgctgcgc
cggatggccgcgctcgtcgacgcgcagaacgccggcgagccggggtaccggccgatggcc
ccggccttcgaggagctggccttcgccgccgcgcgggcgctgctactcgagggcgccgac
cagccgaacggctacaccgaaccgctgttgcacgagcaccggcgcgctcagaagaacaag
gagatggtccgctcatga

DBGET integrated database retrieval system