KEGG   Francisella sp. FSC1006: LO80_06370
Entry
LO80_06370        CDS       T03403                                 

Definition
(GenBank) aspartoacylase
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
frf  Francisella sp. FSC1006
Brite
KEGG Orthology (KO) [BR:frf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LO80_06370
Enzymes [BR:frf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     LO80_06370
SSDB
Motif
Pfam: AstE_AspA Peptidase_M99 DUF1765
Other DBs
NCBI-ProteinID: AIT10306
UniProt: A0A097ERW0
Position
1299731..1300588
AA seq 285 aa
MKISKLLVSGGIHGNEYTGVYIVNRMKKYPLKTKSLKIIPLLANPEAFRLSRRYKDQDLN
RSFSTQDLHNSSLSSYENQRAREIYQLYGAESESPVDFLVDLHTTTSNLGKTVITDGKSP
LVNKLCAYLVEQVDGLKVIKHENITSVAMNNIVPMSLTIEIGAVSTSIYDPNTINVTTEI
VNKIIEFIEQSNCDNAPEVKGCKAYEPVKTISYPRDNDGNINAVIHKNLQGKDFQALNYN
DPIFELMDGNDKFLDVPGRWYPIFINESAYYEKDIAFYLTKEVDL
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaaaattagtaagttattagtatctggtgggattcatggaaatgagtacacaggagtt
tatattgttaatcgtatgaaaaaatatccactaaagactaaatctttaaaaattatacct
ttgttagcgaatccagaagcttttagattaagtagaagatataaagatcaggatttaaac
cgctctttttcaacgcaagatttacataactcttcactaagtagttatgaaaatcaacga
gcaagagaaatctaccaactatatggagctgaatctgaatcaccagttgattttttagtt
gacttacatacgactacctcaaatcttggtaaaactgttattactgatgggaaaagtcca
ttagtaaataagctatgtgcatacttggttgagcaagtagacggtcttaaagtgattaag
catgagaatattactagtgtagcaatgaataatattgttccaatgtctttaactattgag
ataggagctgtaagcacaagtatttatgaccctaatactattaatgtaactacagagatt
gttaacaaaataatagagtttattgagcaatcaaactgtgataatgctccagaagtcaaa
ggatgcaaagcttatgagccagttaagactattagttatccaagagataatgatggaaat
attaatgctgtaattcataagaatctccaaggcaaagattttcaagctcttaattataac
gatcctatttttgaattaatggatggcaacgataagttcttagatgttcctggtagatgg
tatcctatatttataaatgagtctgcatattatgaaaaagatattgcattctaccttaca
aaagaagtcgatctttag

DBGET integrated database retrieval system