KEGG   Francisella sp. FSC1006: LO80_08320Help
Entry
LO80_08320        CDS       T03403                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
frf  Francisella sp. FSC1006
Pathway
frf03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:frf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LO80_08320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:frf03019]
    LO80_08320
   03016 Transfer RNA biogenesis [BR:frf03016]
    LO80_08320
Enzymes [BR:frf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     LO80_08320
Messenger RNA biogenesis [BR:frf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     LO80_08320
Transfer RNA biogenesis [BR:frf03016]
 Prokaryotic Type
  tRNA degradation factors
   LO80_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB S1 OB_RNB RNase_II_C_S1 CSD2 Ras
Motif
Other DBs
NCBI-ProteinID: AIT09971
UniProt: A0A097EQX6
Position
1688499..1690802
Genome map
AA seq 767 aa AA seqDB search
MSKYNIQNDPNKDLEAQKYENPIPSRDVILKYIRDTNLPVSIENIANALEIVKKNLFDGL
VNRLGAMVRDEQLEKDKSYYSLPEMVPIYITSKVTSDRDSRLELFSHTLNTKVGISSHQA
KMVMVGDEVTAKVLGINKRGRIEAEIKSIVSRAQKTVTGYYYKSFDCHFLKPISKNMPND
IVLLPPKQKIEHNSLIEADIIVQPSVNNAAVARFKQEVEAVSPVKEAMMMATQKYDLVEE
WSKKALRYLDNISDDVIVGNRVDLRSKHFVTIDGEDAKDFDDAVYAHKTKSGSWKLYVAI
ADVSNYVEKDSGLDLDAKRRSTSVYFPGYVIPMLPERLSNGLCSLKPNEDRYSLVCEMNI
SKTGKLSRYKFYSAVINSKARLTYTDVANLLEKKQNTIVEKTPKLVPNIFDLYDLYKVLH
EARAERGAIDFDTVETQIILDEHNHIDSIIPRHRNDAHRLIEECMLVANVAAAKFTIKHK
KTSPFRVHSEPKEDRMETLKKYLSRHGIHLAYGKDGKVTPKALAEMLESIKDRPDYDDIQ
MMTLRSMNQAVYSINNDGHFGLAYNEYTHFTSPIRRYPDLVVHRIIKSIIGEYEHGGADY
KPSELSNICENASDQERNADGASKQVENWLKCYFMQDYIGHVLEAQIKHVNGLGLFAELK
DMYIEGLIHVSAIPGDYYIYDETKDILIGKRTHKVYKIGQDITVRVVRADLERIHIDFEL
YDPRSSKPFNENASERPTAKKPKKNKKVKKKRSRRRRKNKDKSKDKA
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaatacaacatacaaaacgatcctaataaggatcttgaagcacaaaaatatgaa
aatccaattcctagcagggatgtgattttaaaatatataagagatactaatcttcctgtt
agtattgaaaatatagcaaatgcacttgaaatagttaagaagaacctttttgatggtctt
gttaatcgattaggtgcaatggttagagatgagcaattagaaaaagataaatcatactat
agtctgccagaaatggtacctatttatataacatccaaagttacttcagatagagattct
cgactggaattatttagtcatactttaaataccaaagtaggaatttcatcacatcaagca
aaaatggtgatggttggtgatgaagtaacagcaaaagtgcttggaataaacaaaagaggc
cgtattgaggcagaaattaaatctatagtttcaagggcgcagaaaacagtaactggatat
tattataagagttttgattgtcattttctgaagcctattagtaagaatatgccaaatgat
attgtcctattaccacctaagcagaaaatagagcataattctttaattgaggcagatata
atagttcagccaagtgttaataatgctgcagtggctagattcaagcaagaagtagaagca
gtatctcctgttaaagaagccatgatgatggcaactcaaaagtatgatttagttgaagag
tggagcaaaaaagctcttagatatttagataatatctctgatgatgtaattgtcggtaat
agagttgatttaagaagtaagcattttgtcacgattgacggtgaagatgctaaagatttt
gatgatgcagtatatgctcataaaactaaaagtggtagctggaaactatatgttgctatt
gcagatgtatcaaactatgttgaaaaagattctggcttagatttagatgctaaacgccgt
tcgacatcggtatattttcctggttatgtaattccaatgttacctgagagattatcgaat
ggtttatgttcattaaagcctaatgaagatagatattctcttgtttgtgagatgaatatt
tctaaaacaggtaagctttcaagatataaattctactcagctgtaattaattcaaaagct
aggcttacatatacagatgtagctaaccttttagaaaagaagcaaaatactatagttgag
aaaactccaaagctagttccaaatatttttgacttatatgatttgtataaagtattacat
gaagcaagagctgaaagaggtgcgatagattttgatactgtagagacacaaatcatatta
gatgaacataaccatatagactcaattatacctagacatcgtaatgatgctcatagattg
attgaagagtgtatgcttgtagccaatgtcgctgcagctaaattcacaattaaacataag
aaaacatcgccatttagagttcatagtgaacctaaagaagacagaatggaaacacttaaa
aagtacttatctaggcatggaatacatcttgcttatggtaaagatggaaaggttacacca
aaagccttagctgaaatgctagagagtattaaagatcgtccagactatgatgatattcag
atgatgactcttcgtagtatgaatcaagcagtttatagtataaataatgatggacatttt
ggcttagcatataatgaatacacacattttacatcgccaattcgtagatatcctgattta
gtagtacatagaattattaagtcaatcattggtgagtatgaacatggcggtgctgattat
aagccttctgaactatcaaatatttgtgagaatgcttcagatcaagagagaaatgcagat
ggtgcttcaaaacaggtagaaaattggttgaagtgttactttatgcaagattatattggt
catgtattagaagctcagattaagcatgttaatggtttaggactgtttgcagagctaaaa
gatatgtatatcgaaggattaatacatgtatcagctattcctggcgattattatatttat
gatgaaactaaagatattctgattggtaaaagaactcataaagtttataaaattggtcaa
gatataactgtaagggttgttcgagcagatttagaaaggatacatattgattttgaatta
tatgatcctcgaagcagtaaaccttttaatgaaaatgcttctgaaagacctactgctaaa
aaacctaagaaaaataaaaaagttaaaaagaaaagatctagacgtagaagaaaaaataaa
gataagtcaaaagataaggcttaa

DBGET integrated database retrieval system