KEGG   Francisella sp. FSC1006: LO80_08475Help
Entry
LO80_08475        CDS       T03403                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
frf  Francisella sp. FSC1006
Pathway
frf00020  Citrate cycle (TCA cycle)
frf00480  Glutathione metabolism
frf01100  Metabolic pathways
frf01110  Biosynthesis of secondary metabolites
frf01120  Microbial metabolism in diverse environments
frf01130  Biosynthesis of antibiotics
frf01200  Carbon metabolism
frf01210  2-Oxocarboxylic acid metabolism
frf01230  Biosynthesis of amino acids
Module
frf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
frf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:frf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LO80_08475
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LO80_08475
Enzymes [BR:frf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LO80_08475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIT10000
UniProt: A0A097EQZ7
Position
1722571..1724787
Genome map
AA seq 738 aa AA seqDB search
MHKIFYTFTDEAPALATGSFLPIVESFTKTVDIELETKDISLASRILANFSDCLSNDQKC
SDDLAILGDLAKTPDANIIKLPNISASIPQLTAAIKELQAKGYKIPDYPFEPKDDKEQEI
KNRYSKVLGSAVNPVLREGNSDRRVAEAVKKYAEKHPHSMGEWSKDSKSHVASMTADDFY
ANEKSYIVPKATTVKIVHTCPKGAQTVLKEGLALEEKEIIDATKISAKALREFYKTEIAK
AKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDVFKKYAKEFKELGVNPRNGWGDAVE
KIKQLPQDVQDKINADIEKVFVKQPDIAMVNSDKGITNLNVPSDVIIDASMPAAIRSSGQ
MWNKNNELQDMKAMIPDRCYAGVYAATIDFCKENGAFDVATMGDISNVGLMAKKAEEYGS
HDKTFEIQADGNVEVIDADGNVILEHQVEKGDIWRACQTKDIAVKDWVKLAVNRAKITQN
PAIFWLDSNRAHDRNLIAKVNEYLTHHDTTGLDIQILSPIEATKYSLKRMKEGKNTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLLAGGGLFETGAGGSAPKHVEQLINENHLRWD
SLGEFLALGASLEDLAIKTREAKIKVLAEALAQANKDFLDNDKSPKRKVGELDTRGSHFY
LAFYWVKALAEQTGNAELKAKFEPIYAELKANEEKIVKELAAVQGKKADIGGYYLPKKAK
LIEVMRPSKTLNSIMAKI
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattctatacatttacagatgaagcaccagctctagcgactgggtcattt
ttaccaattgttgaaagttttacaaaaactgttgatattgaattagagacaaaagatata
tcattagcatcacgcatattagcaaattttagtgattgtttatctaatgaccaaaaatgc
tcagatgatttagcaattttgggagatctagcaaaaactcctgatgctaatattatcaag
cttcctaatattagtgcatcaattcctcagttaacagctgctatcaaagagcttcaagcg
aaaggatataagattcctgattatccatttgagccaaaagatgataaagaacaagaaatc
aagaatcgttactcaaaagttttaggtagtgcggtaaatcctgtattaagagaaggtaac
tctgatcgtagagtagcagaggcagttaaaaaatatgctgagaaacatccacattctatg
ggtgagtggtcaaaagattcaaagtctcatgttgcaagtatgactgctgatgacttttac
gcaaatgagaaatcttacatagtgccaaaagcaactactgttaagattgtacacacatgt
cctaaaggagcccaaacagttcttaaagaaggtcttgctttagaagagaaagaaatcata
gatgctacaaaaatttctgcaaaagctctgagagagttctataagactgaaatagcaaaa
gctaaaaaagaagggactctactttcacttcatttaaaagctacaatgatgaaagtttca
gatccaatcttatttggtcatgctgttgagatcttctttgaagatgttttcaaaaaatat
gctaaagagtttaaagagctaggtgtaaatcctcgtaatggttggggtgatgctgttgag
aaaattaagcaactacctcaagatgttcaggataaaattaatgctgatattgaaaaagta
tttgttaagcaacctgatattgctatggttaattctgataaaggcattacaaacttgaat
gtaccaagtgatgtgattatcgatgcttctatgcctgcagctatccgttcatctggtcaa
atgtggaataaaaataatgagcttcaagatatgaaagctatgattccggatagatgttat
gctggcgtgtatgctgcaactattgatttctgcaaagagaatggtgcttttgatgttgct
actatgggagatatttccaatgtgggtctaatggctaaaaaagcagaagagtatggctct
catgataaaacatttgaaatccaagcagatggtaatgtagaagttatcgatgctgatggt
aatgtaatactcgagcatcaggtagaaaaaggtgatatttggagagcttgtcaaaccaaa
gatatcgcagtaaaagattgggttaaattagctgttaatagagctaaaattactcaaaac
cctgcaatattctggttagattcaaatagagcacatgatagaaatttgattgctaaggta
aatgaatatttaactcatcatgatactactggtttagatatccagattttatcaccaatt
gaagctacaaaatattctctaaaaagaatgaaagaaggcaaaaatacaatctctgtaacc
ggtaatgttttaagagattacttaacagatcttttcccaattctagagcttggtacttct
gctaagatgctttcaattgtacctcttttagctggtggtggattgttcgagactggtgct
ggtggatctgctcctaagcatgttgagcaacttattaatgaaaatcatttaagatgggat
tcattgggcgagttcttagcattaggagcttcattagaagatttggcaattaaaactaga
gaagctaaaatcaaagtattagcagaggctcttgctcaagctaataaagatttcttagat
aatgataagtcaccaaagcgtaaagttggcgaacttgatactagaggaagtcacttttat
ttggcattttactgggtgaaagcattagctgagcaaactggtaatgctgagttaaaagct
aaatttgagcctatctatgcagagttaaaagcaaatgaagaaaaaattgttaaagaacta
gcagctgtgcaaggtaaaaaagcagatataggtggttattacttacctaaaaaagctaag
ttaatagaggttatgcgtcctagtaaaactttaaattctatcatggcaaaaatataa

DBGET integrated database retrieval system