KEGG   Frankia inefficax: FraEuI1c_1309
Entry
FraEuI1c_1309     CDS       T01354                                 

Definition
(GenBank) Acyl-CoA dehydrogenase type 2 domain protein
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
fri  Frankia inefficax
Pathway
fri01057  Biosynthesis of type II polyketide products
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    FraEuI1c_1309
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:fri01008]
    FraEuI1c_1309
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     FraEuI1c_1309
Polyketide biosynthesis proteins [BR:fri01008]
 Polyketide tailoring proteins
  Oxygenase
   FraEuI1c_1309
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_1
Other DBs
NCBI-ProteinID: ADP79376
UniProt: E3J3N9
Position
1638662..1639795
AA seq 377 aa
MSTTINAGHDLVHAARRVAGIAAEHASDANRHRRLHPDVVEAITEAGFLRAFVPSAVGGA
AGSLREFSGAVAAVGERCASAAWVASVSAYVGRMAGFLPAPGWAEVWSAGPDTLLVGALM
PAGSATAVPGGWLVSGEWAYISAVDFSAWALVCALAPGDGGPQARFFAVPREAYSIRDTW
HTTGMRGTGSNTLVLPEVFVPAHRSVARSRIAAGQGSDSPAPCHNVPLGAINGLAFGGPA
LGAARGMLAAWSATTARKLGGGRGRPVDRAAFDGPLTWASAGIDTAELLFDRVAATADAG
DPGPLLSARGSRDSVVAISHLVDAANRVFAASGSSAQAEDSPIGRAWRDVHAAASHVAVR
FEPAAAAYADEILRAPA
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtcaaccacgatcaacgccggtcacgacctggtccacgcggcgcggcgggtcgccggc
atcgcggccgagcacgcgtccgacgccaaccgtcaccgccgcctccaccccgacgtcgtc
gaggcgatcaccgaggccggcttcctgcgggcgttcgtgccgagcgcggtgggcggcgcg
gccggctccctccgcgagttctccggggccgtcgccgcggtcggcgagcgctgcgcgtcc
gcggcctgggtcgcctcggtcagcgcctacgtcggccggatggccggtttcctgcccgcg
ccagggtgggccgaggtctggtcggccggtcccgacaccctgctcgtcggcgccctcatg
ccagccggatcggccaccgcggtgcccggcggctggttggtgtccggcgaatgggcctac
atcagcgcggtcgacttctcggcctgggccctggtctgcgcgctggcgccgggcgacggc
ggcccgcaggcccggttcttcgccgtcccgcgcgaggcctactccatccgcgacacctgg
cacaccaccggcatgcgcggcaccggcagcaacacgctggtgctgccggaggtcttcgtc
ccggcgcaccggtcggtcgcccggtcccggatcgccgccggtcagggctccgattccccg
gcgccctgccacaacgtcccgctcggcgcgatcaacggcctggccttcggcggcccggcg
ctcggtgccgctcgcgggatgctggccgcctggtcggccacgacggcgcggaagctcggt
ggcggccggggccggccggtggaccgcgcggccttcgacgggccgctgacctgggcgtcg
gccgggatcgacacggccgagctgctgttcgaccgggtcgcggcgacggccgacgccgga
gatccggggccgctgctctcggcccgcggctcccgggacagcgtggtggccatcagccac
ctggtcgacgcggcgaaccgggtgttcgccgcgagtggcagctcggcccaggccgaggac
agccccatcggccgggcctggcgggacgtgcacgcggcggccagccacgtcgccgtccgg
ttcgagccggccgccgccgcgtacgcggacgagatcctgcgggccccggcctga

DBGET integrated database retrieval system