KEGG   Frankia sp. EuI1c: FraEuI1c_1975Help
Entry
FraEuI1c_1975     CDS       T01354                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00620  Pyruvate metabolism
fri00630  Glyoxylate and dicarboxylate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FraEuI1c_1975
   00630 Glyoxylate and dicarboxylate metabolism
    FraEuI1c_1975
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FraEuI1c_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI DUF3455
Motif
Other DBs
NCBI-ProteinID: ADP80025
UniProt: E3ITX8
Position
2419361..2421049
Genome map
AA seq 562 aa AA seqDB search
MGATGESAGATDGVEVEREVAGLDASDAASLAADVLTDDAVAFVAGLQRAFGARRSELLA
NRARRRAAIAAGGSLDFLPETAEVRAGAWTVAPPAPDLADRRCEITGPTDAKMVINALNS
GARLFMADFEDANVPTWANLLDGQRNLTAAIAGTLSFTNPDGRVYRLVDRPATLVVRPRG
WHLPERHVMVDGAAVSGSLFDAGLYLFRNARTLAAAGRTPAFYLPKMESHLEARLWNDVF
GFAEDALRLAQGTIRATVLIETLPAAFEMDEILYELREHSAGLNAGRWDYLFSTIKTFAA
RPGEFLLPDRNAVTMTAPFLRAYTELLVSTCHRRGAHAIGGMAAFIPSRRDPAVNAAALA
KVRADKVRESGDGFDGSWVAHPDLVPVCTEVFDGVLGAAPNQLSRQRPDVHVTADALLDV
AATPGEITEQGVRINISVGLRYLETWLRGSGAVGIDNLMEDAATAEISRSQLYQWVAAGA
KLADGRVVTAELVRQILAEEVARLSPSGPVPDAEAGSLPGAGESAEAGKAGGRWADALEL
FEQTALGEPFAEFLTLPAYDRI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgacaggcgagtcagcgggcgcgacggacggcgtcgaggtcgagcgggaggtg
gccgggctcgacgcctcggacgcggcctcgctcgccgcggacgtgctcaccgacgacgcg
gtggcgttcgtcgccgggctgcagcgcgcgttcggcgcgcggcgctccgaactgctggcc
aaccgggcccggcggcgggccgcgatcgccgcgggcggatcgctggacttcctgcccgag
acggccgaggtccgcgccggcgcctggacggtcgccccacccgccccggatctggccgac
cgccgctgcgagatcaccggcccgacggacgcgaagatggtcatcaacgccctcaacagc
ggcgcccggctgttcatggcggacttcgaggacgccaacgtccccacctgggcgaacttg
ctcgacggccagcgcaacctcaccgcggcgatcgcgggcacgctgtccttcaccaacccg
gacggccgcgtctaccggctcgtcgaccggcccgcgaccctggtcgtccggccgcgcggc
tggcatctgcccgagcggcacgtcatggtcgacggcgccgccgtgtccggctcgctgttc
gacgccgggctctacctgttccgcaacgcgcggaccctcgcggcggccggccggaccccg
gcgttctacctgccgaagatggagagccacctcgaggcccggctgtggaacgacgtgttc
ggcttcgccgaggacgccctgaggctcgcccagggcaccatccgggccaccgtgctgatc
gagacgctcccggccgcgttcgagatggacgagatcctctacgagctgcgcgagcactcc
gccgggctcaacgcgggccgctgggactacctgttctccacgatcaagacgttcgccgcc
cggcccggcgagttcctcctgcccgaccgcaacgccgtgacgatgaccgcgccgttccta
cgggcgtataccgaactgctcgtctcgacctgccatcggcgcggcgcgcacgcgatcggt
ggcatggcggcgttcatcccgtcgcggcgcgaccccgcggtgaacgcggccgccctggcg
aaggtccgggccgacaaggtccgcgagtccggggacgggttcgacggcagctgggtcgcg
catcccgacctcgtccccgtctgcaccgaggtcttcgacggcgtcctgggcgccgcgccc
aaccagctcagccggcagcgccccgacgtccacgtcaccgccgacgcgctcctcgacgtc
gccgcgacccctggcgagatcaccgagcagggggtgcggatcaacatcagcgtcgggctg
cgctacctggagacctggttgcgcggctccggcgcggtcggcatcgacaacctgatggag
gacgcggccaccgcggagatctcgcgcagccagctctaccagtgggtcgccgccggcgcg
aagctcgccgacggccgggtcgtcaccgccgagctggtccgccagatcctcgccgaggag
gtcgctcggctgagcccgtcgggcccggtcccggacgcggaagcgggctctctgccgggc
gccggcgaatcggccgaggccggaaaggccggcgggcgatgggcggacgccctcgagctt
ttcgagcagaccgcgctcggtgaacccttcgccgagttcctcacactgcccgcctacgac
cggatctga

DBGET integrated database retrieval system