KEGG   Frankia sp. EuI1c: FraEuI1c_2723Help
Entry
FraEuI1c_2723     CDS       T01354                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00020  Citrate cycle (TCA cycle)
fri00620  Pyruvate metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
Module
fri_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_2723
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_2723
   00620 Pyruvate metabolism
    FraEuI1c_2723
Enzymes [BR:fri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FraEuI1c_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADP80754
UniProt: E3J6H8
Position
3313077..3314504
Genome map
AA seq 475 aa AA seqDB search
MTGRDFLLPDLGEGLAEAEIVQWLVRPGDPVALNQPLVEVETAKAAVEIPSPYAGVVAAL
HCAEGELVPVGTALLTVAAESVADAATGAEEAPPAPVVGRAPVEPAPGEVPRRRPRRAAH
TGLVAAAAAAPVQTAGPVLGAERRAPVARVALAPQRPAAPLVPAPNGLPRAKVLAAPPVR
KLARDLGVDLGTVHPTGPNGTIARADVTAAATPVPDPGPPRPAPSGVRPGERLPVRGVAR
QMALAMEHSAFQVPQATVQRTVDVTGLLDLLARWRADPPAGQVTAGQAPGGDRPVRITSL
AFISRAVVAAVARHPLANARWLTAADGSNEIEVYPAVNLGVAVASERGLVVPVIPAADRL
GLTALAGELASLVEAARAGRTPPARMRGSTITVSNVGVFGVDSAAGLVREGEAALVVLGA
IRDAAAVWQGEVQVRRVMTVSVSFDHRILHGEAASRFLGEIAAVLADPVSLLLHG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacggggcgggacttcctgctgcccgacctgggggagggcctcgcggaggccgagatc
gtccagtggctggtacgccccggcgacccggtggcgctcaaccagccgctcgtggaggtc
gagaccgcgaaggcggccgtcgagatcccgtcgccctacgccggcgtggtggcggccctg
cactgcgcggaaggtgagctcgtccccgtcgggacggccctgctgaccgtcgccgccgag
tcggtcgccgacgcggcgaccggggccgaggaggcgccgccggccccggtcgtcggccgg
gccccggtcgagccggcgcccggcgaggtgccgcgccgccggccccgtcgggccgcccac
acggggctcgtggccgccgcggcggcagccccggtccagaccgctggcccggtcctcggg
gcggagcgccgcgcgccggtcgcccgggtcgcgctcgctccccagcgccctgcggccccg
ctggttccggcgccgaacggtctgccgagggccaaggtgctggccgccccgccggtgcgc
aagctcgcccgcgacctcggcgtcgacctgggtacggtccacccgaccgggccgaacggc
accatcgcccgggccgacgtcacggcggccgccacaccggtcccggaccccgggccgccg
cgcccggcgccgtcgggcgtccggccgggcgagcgcctcccggtgcgcggcgtcgcgcgc
cagatggcgctggcgatggagcacagcgcgttccaggtgccacaggccacggtccagcgg
accgtcgacgtcaccggcctgctggacctgctcgcccgctggcgggcggacccgccggcc
ggccaggtcacagccggccaggcacccggcggcgaccggccggtcaggatcacgtcgctg
gccttcatcagccgcgccgtggtcgccgcggtcgcgcgccacccgctggcgaacgcccgc
tggctgacggccgccgacggctccaacgagatcgaggtgtacccggcggtcaacctgggc
gtggcggtggccagcgagcgcgggctcgtcgtcccggtgatccccgccgccgaccggctc
gggctgaccgccctggccggcgagctggcgagcctggtcgaggccgcgcgcgccgggcgc
accccaccggcgcggatgcgcggctcgacgatcaccgtgtccaacgtcggcgtcttcggg
gtggactcggccgccgggctggtccgcgagggcgaggcggccctggtcgtgctcggcgcg
atccgggacgcggccgccgtctggcagggagaggtccaggtccgccgggtgatgacggtc
tccgtgtccttcgaccaccggatcctgcacggcgaggccgcgtcgaggttcctgggcgag
atcgccgccgtgctcgccgacccggtcagcctgctgctgcacggctga

DBGET integrated database retrieval system