KEGG   Frankia inefficax: FraEuI1c_3524Help
Entry
FraEuI1c_3524     CDS       T01354                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
fri  Frankia inefficax
Pathway
fri00860  Porphyrin and chlorophyll metabolism
fri01100  Metabolic pathways
fri03030  DNA replication
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_3524
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FraEuI1c_3524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fri03032]
    FraEuI1c_3524
Enzymes [BR:fri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     FraEuI1c_3524
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     FraEuI1c_3524
DNA replication proteins [BR:fri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     FraEuI1c_3524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: ADP81533
UniProt: E3IZA6
Position
complement(4341079..4342245)
Genome map
AA seq 388 aa AA seqDB search
MAAKVVIEADGGSRGNPGPAGYGALVRDADSGALLAERAGAIGVATNNVAEYQGLIAGLR
AAAEVAPDADVEVRMDSKLVVEQMSGRWKIKHPAMRPLAAEAAELVAARPSPVRYRWIPR
ERNKDADRLANEAMDAAAAGRTWEPSTPQSPDPAPVETPATRRLTGWVAPPAPPTWTVLL
RHGQTKVSVEKRFGGLVDAPLTEVGLAQAAAAAGRLRGEAFDAVLTSPLRRARQTAEAAL
PGLAPAAGRDEVELVVDEQLRETDFGVWEGLTFAEARERHPDELSAWLADPAVPPPGGES
LAATIERVRVALDRHRAERPGGRLLVVTHMGPIKSAASLALAAGPGVFYRLHLDLASLTT
IAWYADGPAVLHAFNDVSHLPGASLAGE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgaaggtcgtcatcgaggctgacggcgggtcgcggggcaaccccggcccggcc
gggtacggcgctctcgtgcgggacgccgacagtggcgccctgctggccgagcgggccggc
gcgatcggcgtcgccaccaacaacgtcgccgagtaccaggggctgatcgcggggctgcgg
gccgcggccgaggtggcgccggacgccgacgtcgaggtccggatggactcgaagctcgtc
gtcgagcagatgagcggccggtggaagatcaagcacccggcgatgcggccgctggcggcc
gaggcggccgagctcgtcgccgctaggccgtccccggtccgctaccggtggattccgcgc
gagcgcaacaaggacgccgaccggctggccaacgaggcgatggacgcggcggccgcgggc
cgcacctgggagccgtcgacgccgcagtcccccgacccggctccggtcgagaccccggcc
acccggcggctgaccggctgggtcgcgccgcccgcgccgccgacctggacggtgctgctg
cgccacggccagacgaaggtgtcggtcgagaagcggttcggcggcctggtcgacgcgccg
ctgaccgaggtcggtctggcccaggccgcggcggcggcgggccggctgcgcggcgaggcg
ttcgacgccgtcctcacctcaccgctgcgccgggcccgccagaccgccgaggcggcgctg
cccggcctggccccggcggccgggcgcgacgaggtggagctcgtcgtcgacgagcagctg
cgggagaccgacttcggggtgtgggaggggctgacgttcgccgaggcgcgggaacgccac
ccggacgagctgtccgcgtggctggccgacccggccgtcccgccgcccggcggggagagc
ctcgcggcgacgatcgaacgagtccgggtcgcgctcgaccggcaccgggccgaacgcccc
ggcggccggctgctcgtcgtcacccacatggggccgatcaaatcggccgcgtcgctggcg
ctggccgccggccccggggtcttctaccggctccatctggatctggcgtcgctgacgacg
atcgcctggtacgcggacggaccggccgtcctgcacgccttcaacgacgtgagccacctg
ccgggcgcctcgctggccggcgagtag

DBGET integrated database retrieval system