KEGG   Frankia inefficax: FraEuI1c_4108Help
Entry
FraEuI1c_4108     CDS       T01354                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
fri  Frankia inefficax
Pathway
fri00360  Phenylalanine metabolism
fri00362  Benzoate degradation
fri00621  Dioxin degradation
fri00622  Xylene degradation
fri01100  Metabolic pathways
fri01120  Microbial metabolism in diverse environments
fri01220  Degradation of aromatic compounds
Module
fri_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FraEuI1c_4108
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FraEuI1c_4108
   00622 Xylene degradation
    FraEuI1c_4108
   00621 Dioxin degradation
    FraEuI1c_4108
Enzymes [BR:fri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     FraEuI1c_4108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm IRS
Motif
Other DBs
NCBI-ProteinID: ADP82109
UniProt: E3J990
Position
5001288..5002430
Genome map
AA seq 380 aa AA seqDB search
MNAENAGAAEATTNAPGTAAPIAPCGPETGASVADVPVTAPLYIQDVTLRDGMHAIRHRY
TVAQAATIARLLDEAGVSAIEVAHGDGLAGSSVNYGVGAHTDWEWIEAVVGSMSRAIPTT
LLLPGIGTLHDLRRAHELGIRSVRIATHCTEADISAQHITAARELGLDVAGFLMMSHLAP
PAELARQAKLMESYGAHCVYVTDSGGRLSMDDVRARFRAYRDLLDPATELGIHAHHNLGL
GVANSVVAAESGAIRIDASLAGQGAGAGNCPLEAFIAVADVMGWKHGCDLFGLMDGADDV
VRPLQDRAVRVDRETLTLGYAGVYSSFLRHAETAARRYGLDTRSILVEVGRRGMVGGQED
MITDVALDLVAARPPQAPRG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgagaacgccggcgcggccgaggccacgacgaacgcgcctgggacagcggcc
ccgatcgcaccctgcggaccggaaacaggcgccagtgtcgccgacgtccccgtgaccgca
ccgctctacatccaggacgtgaccctgcgggacggcatgcacgccatccggcatcgctac
accgtcgcgcaggccgccacgatcgcccggctcctcgacgaggccggggtgtccgccatc
gaggtcgcgcacggcgacggcctcgccggctcgtcggtcaactacggcgtcggcgcgcat
accgactgggagtggatcgaggccgtcgtcgggtcgatgtcccgcgccatccccaccact
ttgctgctgccgggcatcggcaccctgcacgacctgcggcgcgcccacgaactgggcatc
cgttcggtccggatcgccacccactgcaccgaggccgacatctccgcgcagcacatcacg
gccgcccgcgagctgggcctggacgtcgccgggttcctgatgatgtcccacctggcccca
ccggccgaactcgcccggcaggcgaagctcatggagtcctacggcgcgcactgcgtctac
gtcaccgactccggcggacgcctgagcatggacgacgtccgggctcgcttccgcgcctat
cgcgacctgctcgacccggcgacggagctgggcatccacgcccaccacaacctgggcctc
ggcgtcgcgaactcggtcgtcgcggccgagtccggcgccatccggatcgacgcgtctctc
gccggccagggcgcgggcgccggcaactgcccgctggaggcgttcatcgccgtcgcggac
gtgatgggctggaagcacggctgcgacctgttcggcctgatggacggcgccgacgacgtc
gtccgcccgctgcaggaccgggccgtccgcgtcgaccgggagaccctcaccctcggctac
gccggcgtctattcgtcgttcctgcggcacgcagaaaccgccgcccgccgctacggcctg
gacacccggtcgatcctcgtcgaggtcggccgacgcggcatggtcggcggccaggaagac
atgatcaccgacgtcgccctcgacctcgtcgccgcacgcccgccgcaagcaccgagaggc
tga

DBGET integrated database retrieval system