KEGG   Frankia sp. EuI1c: FraEuI1c_4121Help
Entry
FraEuI1c_4121     CDS       T01354                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00620  Pyruvate metabolism
fri00640  Propanoate metabolism
fri00680  Methane metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_4121
   00620 Pyruvate metabolism
    FraEuI1c_4121
   00640 Propanoate metabolism
    FraEuI1c_4121
  Energy metabolism
   00680 Methane metabolism
    FraEuI1c_4121
Enzymes [BR:fri01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FraEuI1c_4121
Lipid biosynthesis proteins [BR:fri01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FraEuI1c_4121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADP82122
UniProt: E3J9A3
Position
complement(5017700..5019292)
Genome map
AA seq 530 aa AA seqDB search
MVDPATRAEQLVASYSAPSLDVAQLLCDRHPGHAVAARVIGEDLAETTVTYAELSESSRR
FAAVLSERGIGRGDRVATLMGKSVDLLTVLVGIWRVGAVYVPLFTAFAEAAVTDRLRRSQ
TRLVIVDPDQRHKIGDGAWVVLPADEVASEVARAQPWEPRSVAVGGAGALVHMFTSGTTG
SPKGVVHPAAYIGGWHSYQEFGLGVGAGSVFWSAADPGWAYGLYTAIVAPLAAGIPTVLL
RGGFSAEATQWVLAELKVTNFAAAPTAYRGLRNSGQLQPGTLDVPYLSSAGEPLTPDVNV
WAPEALGARVHDHYGQTEVGMPIGFPHHEAVAVPVVDGAMGVALPGWSATVLAPDRDEPA
EPGTVGRLALVVADSPFMTFTAYADGDDHGRFVGDGRYYVTGDTASIDVAGIVRFSSRDD
DVIIMAGYRIGPFDVESVLAQHPAVAECAVIAAPDETRGEVVEAYVVAAPGSAVTEDELR
RWVKDRYSAHAYPRRVHFVASLPKTPSGKIQRAELRRQRRAEVLGGRGSR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacccggcaacgcgcgccgaacagttggtggcgagctactcggcgccatcgctc
gacgtcgcccagttactgtgcgatcgccacccgggtcacgcggtcgcggcgcgggtgatc
ggggaggacctggccgagacgacggtcacctacgcggagttgtccgagtcatcgcggcgg
ttcgccgccgtgctgagcgagcgcggcatcgggcgtggtgaccgggtggcgacgctgatg
ggcaagagcgtcgacctgctcaccgtgctggtcgggatctggcgcgtgggtgcggtgtac
gtcccgctgttcaccgccttcgccgaggccgccgtgaccgaccggctgcgtcgctcgcag
acccgtctggtgatcgtcgaccccgatcagcgccacaagatcggcgacggtgcctgggtg
gtgctcccggccgacgaggtggcgtccgaggtggcacgtgctcagccctgggaaccgcgc
tcggtcgcggtcgggggagccggcgcgttggtgcacatgttcacctcgggtacgactggg
tccccgaagggcgtcgtgcatccggccgcctatatcggcggctggcacagctaccaggag
ttcgggctcggagtcggcgccggcagtgtgttctggtccgcggcggatcctggctgggcc
tacggtctctacacggcgatcgtcgccccgctggcggccggaataccaacggttctgcta
cgcggcggcttctccgcggaggcgacacagtgggtgctcgcggagctgaaggtgaccaac
ttcgccgccgccccgaccgcctatcgcggcctgcgtaactccggtcagctccagccggga
acgctcgacgtgccgtatctgtccagcgcgggggagccgctgacgccggatgtgaacgtc
tgggcgcccgaggctctgggcgcgcgggtgcatgaccactacgggcagaccgaggtcggc
atgccgatcggtttcccccaccacgaggccgtggcggtgccggtcgtcgacggcgcgatg
ggggtcgcgctgcctggctggtcggcgacggtgctggccccggaccgcgacgagcccgcc
gaacctggaaccgtcggccggctcgcgctcgtcgtcgcggacagcccgttcatgaccttc
acggcgtacgccgacggcgatgaccacggccggttcgtcggcgacggccggtactacgtc
acgggtgacacggcgagcatcgacgtcgccgggatcgtccgcttctcctcccgcgacgac
gatgtgatcatcatggccgggtaccgcatcggcccgttcgacgtggagtcggtgctcgcc
cagcaccccgcggtcgccgaatgcgccgtgatcgccgcgccggacgagacccgcggcgag
gtcgtcgaggcctacgtggtggccgcccccggcagtgctgtcaccgaggacgagctgcgg
cggtgggtcaaggaccggtactccgcgcacgcctacccgcgccgggtccacttcgtggcc
agcctgccgaagacgccgagcggcaagatccagcgggccgagctgcgccggcagcggcgc
gcggaggtcctcggcgggcgcgggtcccgatga

DBGET integrated database retrieval system