KEGG   Frankia sp. EuI1c: FraEuI1c_4972Help
Entry
FraEuI1c_4972     CDS       T01354                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
fri01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FraEuI1c_4972
Enzymes [BR:fri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FraEuI1c_4972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADP82961
UniProt: E3J311
Position
complement(6122761..6123567)
Genome map
AA seq 268 aa AA seqDB search
MTVLDEIIAGVRADLAERESQTPLDVLKQRVEKVPDPRDALAVLRARRVAVIAEVKRRSP
SKGDLANIPDPGKLAGIYETAGAAAVSVLTEKHRFGGSLADLDAVRVAVDVPVLRKDFIV
APYQIWEARAHGADLVLLIVAALDQPRLVGLLERIESLGMTALVEVHDEEETHRALDAGA
RLIGVNARDLKTLEIRRDTFARLAPLVPPGILKVAESGIRGPRDLLGYAEAGADAVLVGE
AAVSGPDPRQTVADLVAAGAHPATKVGR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcctcgacgagatcatcgccggcgtccgcgccgacttggccgaacgcgagtcc
cagaccccgcttgacgtgctcaaacagcgcgtcgagaaggttccggacccgcgcgacgcg
ctggcggtgctgcgcgcccgccgggtcgccgtgatcgccgaggtcaagcggcgcagcccg
tcgaagggtgacctggccaacattcccgacccggggaagctggccggcatctacgagacc
gccggcgccgcggccgtcagcgtgctgaccgagaagcaccggttcggcggctcgctcgcc
gacctggacgccgtccgggtggcggtcgacgtgcccgtgctgcgcaaggacttcatcgtc
gcgccgtaccagatctgggaggcgcgggcgcacggcgccgacctcgtgctgctgatcgtc
gctgcgctcgaccagccgcgcctcgtcggcctgctggagcggatcgagtcgctcgggatg
accgccctcgtcgaggtccacgacgaggaggagacccaccgcgcgctggacgccggcgcc
cggctgatcggcgtcaacgcccgtgacctcaagacgctggagatccggcgggacaccttc
gcgcggctggcgcccctggtgccgcccggcatcctgaaggtcgccgagtccggcatccgc
ggcccgcgtgacctgctcggctacgcggaggcgggcgccgacgcggtgctcgtcggcgag
gccgccgtcagcgggcccgacccacgccagaccgtcgccgacctcgtcgccgccggcgcc
caccccgccaccaaggtcggccgttaa

DBGET integrated database retrieval system