KEGG   Frankia sp. EuI1c: FraEuI1c_5111Help
Entry
FraEuI1c_5111     CDS       T01354                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00071  Fatty acid degradation
fri00280  Valine, leucine and isoleucine degradation
fri00281  Geraniol degradation
fri00310  Lysine degradation
fri00360  Phenylalanine metabolism
fri00362  Benzoate degradation
fri00380  Tryptophan metabolism
fri00410  beta-Alanine metabolism
fri00627  Aminobenzoate degradation
fri00640  Propanoate metabolism
fri00650  Butanoate metabolism
fri00903  Limonene and pinene degradation
fri00930  Caprolactam degradation
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01212  Fatty acid metabolism
Module
fri_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FraEuI1c_5111
   00650 Butanoate metabolism
    FraEuI1c_5111
  Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_5111
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_5111
   00310 Lysine degradation
    FraEuI1c_5111
   00360 Phenylalanine metabolism
    FraEuI1c_5111
   00380 Tryptophan metabolism
    FraEuI1c_5111
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_5111
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FraEuI1c_5111
   00281 Geraniol degradation
    FraEuI1c_5111
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FraEuI1c_5111
   00627 Aminobenzoate degradation
    FraEuI1c_5111
   00930 Caprolactam degradation
    FraEuI1c_5111
Enzymes [BR:fri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FraEuI1c_5111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADP83100
UniProt: E3J5L3
Position
complement(6283476..6284360)
Genome map
AA seq 294 aa AA seqDB search
MTTTDDRATDGSLGELTDYPVAAGKALRVQRRGPVAQVTMLGPGKGNAMGPEFFAELPVV
FAALDADPSVRAVVLAGSGPNFCYGLDLASMLGDLTGTSSRDGGLAGARTAMLGNIRTLQ
RAIDAVAECRKPVAAAVSGWCIGGGVDLLAACDVRFTSRDARFSIREVRVAIVADLGSLQ
RLPAIIGDGHLRELALTGKDIDAARAEKIGLVNDVLPDQAAALAAAHEFADAVAANPPLV
VQGVKEILEVGRAGAVGAGLRYVSTWNAAFLPSHDLNEAVTAFVERRPAQYEGR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacggacgaccgcgcgaccgacggctcgctcggcgagctcaccgactatccc
gtcgcggccggcaaggccctgcgagtccagcgccgcggcccggtcgcccaggtgacgatg
ctcggccccggcaagggcaacgcgatggggcccgagttcttcgccgagctgcccgtggtg
ttcgccgcgctggacgcggacccgtcggtgcgggccgtcgtcctggccggctccgggccg
aacttctgctacgggctcgacctggcctcgatgctcggcgacctgaccgggacgagctca
cgggacggcgggctcgccggtgcccgcaccgcgatgctcgggaacatccggacgctgcag
cgcgcgatcgacgcggtcgccgagtgccgcaagccggtcgccgccgcggtgtcgggctgg
tgcatcggcggtggtgtcgacctcctggccgcctgcgacgtccggttcaccagccgggac
gcccggttcagcatccgcgaggtacgcgtcgcgatcgtcgccgaccttggcagtctccag
cggctgcccgccatcatcggcgacggccatctgcgtgagctggccctgaccggcaaggac
atcgacgccgccagggccgagaagatcggcctggtcaacgacgtgctgcccgaccaggcc
gcggccctggccgcggcgcacgagttcgccgacgccgtcgccgccaacccgccgctggtc
gtccagggcgtcaaggagatcctggaggtcggccgggccggcgcggtcggcgccgggctg
cgttacgtctccacctggaacgcggcctttctgccgtcccacgacctgaacgaggccgtc
accgccttcgtcgagcgcaggccggcccagtacgagggccgctga

DBGET integrated database retrieval system