KEGG   Frankia inefficax: FraEuI1c_5716
Entry
FraEuI1c_5716     CDS       T01354                                 

Definition
(GenBank) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fri  Frankia inefficax
Pathway
fri00100  Steroid biosynthesis
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FraEuI1c_5716
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FraEuI1c_5716
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 BacA
Other DBs
NCBI-ProteinID: ADP83700
UniProt: E3IVP8
Position
7026262..7027332
AA seq 356 aa
MILGFFLPWIAFGAILALHVVLPARWIDGYVRDDQNRPLRYRLNGLLVLVATVGIAVLLV
AAHAVPADELWRHRWAGLAGACVFGLLFTAALVLPAPPTGRPLLADLYLGRRENPRWRGG
RVDAKMFLYLAGAVLLELNVLSFAAHQHRAIGHVSAAVALSAGLLTYFVVDYLTFEHVHL
YTYDLFAERVGFKLGWGCLVFYPYFYCVGLWARAGRPDPHAPLWLLVLAGVVFATGWTLA
RGANMQKFLFKRDPTARAFGLLEPRSVSDGARTLLCGGFWGAARHINYLGEILMATGITL
ALGTPGDLVPWLYPLYYVGLLVPRQIDDDRRCAAKYGPLWDEYRARVRWRIIPGIY
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtgatcctcggcttcttcctcccgtggatcgccttcggcgcgatcctcgccctgcacgtc
gtgctgcccgcccgctggatcgacggctacgtgcgcgacgatcagaaccgaccgctgcgc
taccggctcaacggcctcctggtcctcgtggccaccgtggggatcgccgtcctgctcgtc
gccgcgcacgcggtgccggccgacgagctctggcggcaccggtgggccgggctcgccggt
gcctgcgtcttcggcctgctgttcaccgccgccctcgtgctgcccgccccgccgaccggc
aggccgctgctcgccgacctatacctcggccgccgggagaacccgcgctggcgcggcggc
agggtcgacgcgaagatgtttctctacctggcgggcgcggtgctgctggagctcaacgtc
ctgtcgttcgccgcccaccagcatcgcgcgatcggccacgtcagcgccgccgtcgcgctc
tcggccgggctgctgacctacttcgtggtggactacctcaccttcgagcacgtccacctc
tacacgtacgacctcttcgccgagcgggtgggcttcaagctcggctggggctgcctggtc
ttctacccgtacttctactgtgtgggcctctgggcgcgggccggccggcccgacccgcac
gcgcccctctggctgctggtcctcgccggggtcgtcttcgccaccggctggacgctcgcc
cgcggggcgaacatgcagaagttcctcttcaaacgcgatcccacggcccgcgccttcggc
ctgctggagccgcgttcggtcagcgacggtgcacgcacgctgctctgcggtggtttctgg
ggcgccgcccgccacatcaactacctcggcgagatcctcatggccaccggcatcaccctc
gccctcggcacgcccggtgacctggtgccctggctgtaccccctttattacgtcggactg
ctcgtgccgcgccagatcgacgacgaccgccgctgcgccgcgaagtacggcccgctctgg
gacgagtaccgcgctcgcgtgcgctggcggatcatccccgggatctactga

DBGET integrated database retrieval system