KEGG   Frankia sp. EuI1c: FraEuI1c_5982Help
Entry
FraEuI1c_5982     CDS       T01354                                 

Definition
(GenBank) putative cytochrome c oxidase, subunit III
  KO
K02164  nitric oxide reductase NorE protein
Organism
fri  Frankia sp. EuI1c
Brite
KEGG Orthology (KO) [BR:fri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    FraEuI1c_5982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX3 DUF373
Motif
Other DBs
NCBI-ProteinID: ADP83966
UniProt: E3IZP8
Position
7363294..7363884
Genome map
AA seq 196 aa AA seqDB search
MTTAQPTAPTAQKAPKRVPGEAGMWFFVLFETLIFTSYFGVYLYYRAQHEAAYLQAQSHL
DLWLGVLGTIALLTSSWSVARCVQTARAGRYQTALRDAALTAGFGVVFLGLKIAEWARQI
HAGNTFTSNDFFQYYFFLTAIHCIHLLIGFVVLGVLVHQLSSPRRRSQEVIETCATYWHT
VDFLWVLIFALLYVVR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgcgcagccgacggccccgacggcgcagaaggccccgaagcgggtgcccggc
gaggcgggcatgtggttcttcgtcctcttcgagaccctgatcttcacctcgtacttcggc
gtctacctctactaccgcgcccagcacgaggccgcgtacctccaggcccagtcgcatctc
gacctctggctcggagtgctcggcacgatcgccctgctgaccagctcgtggtcggtggcc
cggtgcgtccagacggcgcgcgccggccgctaccagaccgccctgcgggacgcggccctg
accgctggcttcggcgtcgtcttcctcgggctcaagatcgccgagtgggcccggcagatc
cacgcgggcaacacgttcaccagcaacgacttcttccagtactacttcttcctcaccgcg
atccactgcattcatctgctgatcggcttcgtcgtcctcggcgtcctcgtccatcagctc
tcgagcccgaggcgacgctcgcaggaggtcatcgagacctgcgccacctactggcacacc
gtcgacttcctctgggtgctgatcttcgctctgctctacgtcgtgaggtga

DBGET integrated database retrieval system