KEGG   Frankia sp. EuI1c: FraEuI1c_5990Help
Entry
FraEuI1c_5990     CDS       T01354                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00071  Fatty acid degradation
fri00350  Tyrosine metabolism
fri00625  Chloroalkane and chloroalkene degradation
fri00626  Naphthalene degradation
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_5990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_5990
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    FraEuI1c_5990
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FraEuI1c_5990
   00626 Naphthalene degradation
    FraEuI1c_5990
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FraEuI1c_5990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP TrkA_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADP83974
UniProt: E3IZQ6
Position
7372042..7373112
Genome map
AA seq 356 aa AA seqDB search
MLMRAARMYGYHEPLRLEEIPVPTPEPDEVLVKVSAAGMCRSDYQLIEGYFEQAAPLEFP
AVPGHEVAGRVAATGSAVPRSAGLSEGDQVVVNPGWGDGTCRQCHEGNEQLCTGSGGWIG
FGPPGGFADYVAVPRRHLIRVPGGDQKAEHLAPLTDAGLTPYRGVKKLRAGGKLGPGRTV
VVAGIGGLGSYAVQYAKLLGGGATVVAFSRTDEKLALARRNGADHTVNTRDLKPGQVQDE
LEALTGRRTVDAILDCAGAPASITLDFEILAAEGVVVSVGLMGTKVEVPLNVIVGTELSY
FGSFWGNYNDLTEVLALAAAGRIQHSVTTVTFEDINDNLQALARGDVVGRQAIVFA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgagagcggcccgcatgtacggctaccacgaaccgttgcggctagaggagatc
ccggtccccaccccggagccggacgaggtcctggtgaaggtgtcggccgcggggatgtgc
cgcagcgactaccagttgatcgagggctacttcgagcaggccgcgccgctggagttcccg
gccgttcccggacacgaggtcgccggccgggtggccgccaccggctccgccgtcccgcgt
tcggccggcctgtccgaaggcgaccaggtcgtggtcaaccccgggtggggcgatggaacg
tgccgccagtgccatgagggcaatgagcagctctgcaccggaagcggcgggtggatcggc
ttcgggcctcccggcggtttcgcggactacgtggcggtcccgcggcgccacctgatccgg
gtgccgggcggtgaccagaaggcggagcatctcgcgccgttgaccgatgccgggctgact
ccctaccgcggggtcaagaagctgcgggcgggcggcaagctcggaccggggcggaccgtg
gtggtggccggcatcggcggcctcggcagctacgccgtgcagtacgcgaagctgctcggc
ggcggcgcgaccgtggtcgcgttctcccggaccgacgagaagctggcgctcgcccggcgc
aacggcgccgatcacaccgtcaacacccgcgacctgaagcccggccaggtacaggacgaa
ttggaggcactcaccggccgccggacggtcgacgcgatcctggactgcgcgggcgccccc
gcgtcgatcacgctcgacttcgagattctcgcggccgagggcgtggtggtgtcggtgggc
ctcatgggtaccaaggtcgaggttccgctgaacgtgatcgtaggaaccgagctctcgtac
ttcggttcgttctggggcaactacaacgacctcaccgaggtcctcgccctcgcggccgcg
gggcgcatccagcacagcgtcaccacggtgacgttcgaggacatcaacgacaacctccag
gcactcgcccgcggcgacgtcgtgggccgccaggccatcgtcttcgcctag

DBGET integrated database retrieval system