KEGG   Frankia sp. EuI1c: FraEuI1c_5994Help
Entry
FraEuI1c_5994     CDS       T01354                                 

Definition
(GenBank) hypothetical protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydrat_N
Motif
Other DBs
NCBI-ProteinID: ADP83978
UniProt: E3IZR0
Position
complement(7377197..7377691)
Genome map
AA seq 164 aa AA seqDB search
MGQLETLVTPELEAQKGVWTDEATSYPVAASDIRKWAIAVYWGETPPRIYWDEAYARSTR
WGGIIAPDDFNPFAWAVPLVRPRPAGAVPGQETKKGGNALNGGMTDKFGVKMRPGDVITT
RSRLTHWEERQGRNGLTLYTYVATEWTNQHGQPVKTRVKTTIRY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggacagctcgaaaccctcgtgacccccgaacttgaagcacaaaagggggtgtggacg
gacgaggcgacctcctacccggtggcggcgtccgacattcgcaagtgggccatcgcggtg
tactggggcgagacgccgccgagaatctactgggacgaggcctacgccaggtcgactcgc
tggggtgggatcatcgccccggacgacttcaatcccttcgcctgggccgtcccgctggtg
cggccgaggccggcgggcgcggtgccaggtcaagagacgaagaagggcggaaacgccctc
aacggcggcatgaccgacaagttcggggtcaagatgcggccaggggacgtcatcaccacc
cgctcccgtctgacgcactgggaggaacgccaaggccgtaacggtctgaccctctacacc
tacgttgcgaccgagtggaccaaccagcacggccagcctgtcaagacgcgagtcaagacg
accattcgctactaa

DBGET integrated database retrieval system