KEGG   Frankia sp. EuI1c: FraEuI1c_5996Help
Entry
FraEuI1c_5996     CDS       T01354                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00010  Glycolysis / Gluconeogenesis
fri00053  Ascorbate and aldarate metabolism
fri00071  Fatty acid degradation
fri00280  Valine, leucine and isoleucine degradation
fri00310  Lysine degradation
fri00330  Arginine and proline metabolism
fri00340  Histidine metabolism
fri00380  Tryptophan metabolism
fri00410  beta-Alanine metabolism
fri00561  Glycerolipid metabolism
fri00620  Pyruvate metabolism
fri00625  Chloroalkane and chloroalkene degradation
fri00903  Limonene and pinene degradation
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FraEuI1c_5996
   00053 Ascorbate and aldarate metabolism
    FraEuI1c_5996
   00620 Pyruvate metabolism
    FraEuI1c_5996
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FraEuI1c_5996
   00561 Glycerolipid metabolism
    FraEuI1c_5996
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_5996
   00310 Lysine degradation
    FraEuI1c_5996
   00330 Arginine and proline metabolism
    FraEuI1c_5996
   00340 Histidine metabolism
    FraEuI1c_5996
   00380 Tryptophan metabolism
    FraEuI1c_5996
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_5996
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FraEuI1c_5996
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FraEuI1c_5996
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FraEuI1c_5996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADP83980
UniProt: E3IZR2
Position
complement(7378595..7380058)
Genome map
AA seq 487 aa AA seqDB search
MAESGYDRTRPAVHLRIGSERLAVGSAGTFEHIDPCTGEVDAVVPLAGPSEIDRAVRLAQ
EAFLVWRDVRPAERRRLLFRLADLIEANADEFTRRAVLDNGMAVTSASGLVGGATEWTRY
YAGFADKISGRVNTSFGPDGEFSYTLAQPYGVIGTIITWNGPLTSLTMKVPPALAAGNTV
VVKPSEMTPFAAELFADLVDEAGFPSGVVSVLPGSVEAGAALVDHPLVQKITFTGGPATA
TAILHACAKQMKPAVLELGGKSANLVFDDADLDTAIPWGTLRVLATVSGQGCAFPTRMLV
QESIYDETLDRVAALVKGIRVGDPWDTDTDIGPVVNEAAAIRILGMIERATQDGARLIAG
GGRPLGLHPGGSFLEPTVFADVDPHSELGQSEVFGPVLSIMPFATEEQAIEIANSTRYGL
SSYIQTKDVRRAHRVAERLEAGATMINGAPNLMVNRPFGGQGYSGYGKEGGPDGLAEFQR
IKTIAMV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggggtacgacaggacgaggccagcggtacatctccggatcggctccgag
cggctggccgtcggttccgcggggaccttcgagcacatcgacccatgcaccggagaagtt
gacgccgtcgtcccgctggccggtcccagcgagatcgaccgggccgtgcggctcgcgcag
gaggctttcctcgtctggcgggacgtgcgcccggcggaacggcgccggctgctgttccgc
ctggccgacctcatcgaggccaacgccgacgagttcacccgcagagcggtcctcgacaac
ggaatggccgtgacctcggcgtccggcctggttggcggcgccacggaatggacccgttac
tacgccggcttcgccgacaagatctccggccgggtcaacacgtcgttcgggccggacggc
gagttcagctacacgctcgcccagccctacggcgtcatcggcaccatcattacctggaac
ggcccgctgacctcgttgacgatgaaggtcccgccggccctcgccgcgggtaacaccgtg
gtcgtcaagccgtcggagatgacaccgttcgccgccgagctgttcgccgacctcgtggac
gaggcgggtttcccgtcgggcgtggtcagcgtgctgccgggttccgtcgaggcgggcgcg
gccctcgtggatcacccgctcgtgcagaagatcaccttcaccggtggcccggcgaccgcg
acggccatcctgcacgcctgcgcgaagcagatgaagccggccgttctcgaactcggcggc
aagtcggcgaacctcgtcttcgatgacgccgatctggacaccgcgatcccgtggggcacc
ctgcgggtgctcgcgacggtcagcggacagggctgcgcgtttccgactcggatgctcgtc
caggaatcgatctacgacgagacgctcgaccgggtcgccgccctggtcaagggaatccgg
gtcggtgacccctgggacaccgacaccgacatcggcccggtggtcaacgaagccgcggcc
attcgcatcctcggcatgatcgagcgggccacacaggacggggccaggctcatcgccggc
ggtgggcgcccgctgggtctccacccgggcggcagcttcctcgagccgacggtcttcgcc
gacgtcgatccgcactccgaactcggtcagagtgaggtgttcggccccgtgctgtcgatc
atgccgttcgcgaccgaggagcaggcgatcgagatcgccaacagcacgcggtacggattg
tcgtcctacatccagaccaaggatgtgcggcgggcgcaccgggtcgccgagcggctcgaa
gccggcgcgacaatgatcaacggcgctccgaatctcatggtcaatcgcccgttcggcggt
cagggctacagcggctatggcaaggagggcggccccgacggtctcgccgagttccagcgg
atcaagaccatcgcgatggtctga

DBGET integrated database retrieval system