KEGG   Frankia sp. EuI1c: FraEuI1c_6003Help
Entry
FraEuI1c_6003     CDS       T01354                                 

Definition
(GenBank) amidohydrolase 2
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ADP83987
UniProt: E3IZR9
Position
7387231..7388499
Genome map
AA seq 422 aa AA seqDB search
MRKEDLILVSIDDHVIEPPDMYKNHVPAKWLDDVPKVVRNSAGVDEWVFQGQSTSTPFGM
AATVGWPREEWGFNPGAFSELRPGCFDVHGRVDDMNVNGILASMCFPTMAGFNARTFSEA
IDKDLSLVMLRAYNDWHIDEWCAAYPGRFIPLGIVPMWDVDLAVAEIRRIARKGCRSISF
LEAPHSQGWPSFLSGHWDPMLQALVDENMVLSLHIGGAWDIVKLAPEAPVDHMIVVPSQL
TMLTAQDLLFGPTLRRFPDLRVALSEGGIGWIPFYLDRVDRHFQNQPWIGNSFGAGKLPS
DVFREHFLACYITDPSGLKMRDTIGVDMIAWECDYPHTDTTWPDSPEFAWNEFQQAGCRD
DEINRITWQNACRFFDWDPFAHRSREDSTVGALRALAAGVDTTRMPREQWRLRNEAAGIG
VF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggaagacctgatcctggtcagcatcgatgaccacgtcatcgagcctccggac
atgtacaagaaccacgtcccggcgaaatggctcgacgacgttccgaaggtggtccggaac
tccgcgggcgtcgacgagtgggtcttccagggccagagcacgtccaccccgttcggcatg
gcggcgacggtcggctggccgcgcgaggaatggggtttcaaccccggcgcgttctcggag
ctgcggccgggctgcttcgacgtgcacgggcgagtcgacgacatgaacgtcaacggcatt
ctcgcgtcgatgtgcttcccgacgatggcgggtttcaacgcccgtaccttctccgaggcg
atcgacaaggacctgtccctcgtcatgctccgggcctacaacgactggcacatcgacgag
tggtgcgcggcctacccgggccgtttcatcccgctcggcatcgtgccgatgtgggacgtc
gacctggcggtcgccgagatcaggcggatcgcccgcaagggctgccgttcgatcagcttc
ctggaggcgccgcactcgcagggctggccgagcttcctgtcgggccactgggacccgatg
ctgcaggcgctcgtcgacgagaacatggtgctctcactgcacatcggtggcgcgtgggac
atcgtcaagctggctcccgaggcgccggtcgaccacatgatcgtggtgccgtcgcagctg
acgatgctcaccgcccaggatctgctgttcggcccgaccctgcgccggttcccggacctg
cgggtcgctctctccgagggcgggatcggctggattccgttctacctggacagggttgac
cgccacttccagaaccagccgtggatcggcaacagcttcggcgccggcaagctgccctcg
gacgtgttccgcgagcacttcctcgcctgctacatcaccgacccctcgggcctgaagatg
cgcgacacgatcggcgtcgacatgatcgcctgggagtgcgactacccgcacacggacacc
acctggcccgactcccccgagttcgcctggaacgagttccagcaggccggctgccgcgac
gacgagatcaacaggatcacctggcagaacgcctgccggttcttcgactgggatccgttc
gcgcacaggtcgcgggaggactcgacggtgggagcgcttcgtgccctcgccgcgggcgtc
gacaccacgaggatgccgcgcgagcagtggcgtctacgcaacgaagccgccggcatcggc
gttttctga

DBGET integrated database retrieval system