KEGG   Frankia sp. EuI1c: FraEuI1c_6014Help
Entry
FraEuI1c_6014     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF214
  KO
K09811  cell division transport system permease protein
Organism
fri  Frankia sp. EuI1c
Pathway
fri02010  ABC transporters
Module
fri_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:fri00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FraEuI1c_6014
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fri03036]
    FraEuI1c_6014
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fri02000]
    FraEuI1c_6014
Chromosome and associated proteins [BR:fri03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    FraEuI1c_6014
Transporters [BR:fri02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    FraEuI1c_6014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-ProteinID: ADP83998
UniProt: E3IZT0
Position
complement(7400882..7401754)
Genome map
AA seq 290 aa AA seqDB search
MRIGPLLAILGAGLRRNLAVTSAVVITAAVCLAMLGAGLLLRAEVHTIDGYLLDQLEVVI
DLSDGITPAQRAALISDLKADPTVVDVRYENKQQVYDRFERDFRASPDVVSGVTAADLPA
ALRLRLVDPRDGDQIVLGYTGRDGVEAVRDQHALLSPLYRMLDGFSVAAFVLAAVQAAAS
GLLIYTMIRVSAHSRRRETAIMRLVGATNATVRAPFVLECALSGLIGGAVAAGALVAAKA
FLVDGRFAHQTMFPLFGWDAVWVAVAAVMAVGALAAAAMGSLALRRHLHA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcgggccgctgctcgcgattctcggcgcggggctgcggcgcaacctggcggtg
acctcggcggtggtcatcacggccgcggtctgcctggcgatgctcggcgccggcctgctg
ctgcgcgccgaggtccacacgatcgacggctacctgctcgaccagctggaggtcgtcatc
gacctctccgacggcatcacccctgcccagcgcgccgccctgatctccgacctgaaggcc
gacccgaccgtggtcgacgtccggtatgagaacaagcagcaggtgtacgaccggttcgag
cgggacttccgggcgtcccccgatgtcgtgtccggggtgacggccgccgacctgcccgcc
gcgctgcgcctgcgcctggtcgatccgcgggacggcgaccagatcgtgctggggtacacc
ggccgcgacggggtcgaggcggtccgcgaccagcacgcgctgctcagcccgctgtaccgg
atgctcgacgggttcagcgtcgccgcgttcgtgctcgccgccgtgcaggcggccgcgtcg
ggcctgctgatctacacgatgatccgtgtctccgcgcactcccggcgccgggagacggcc
atcatgcgcctggtcggggcgacgaacgcgacggtccgggcgccgttcgtgctggaatgc
gcgctgtcggggctgatcgggggtgccgtggcggctggcgcgctcgtcgcggccaaggcg
ttcctggtcgacgggcggttcgcccatcagacgatgttcccgctgttcggctgggacgcg
gtctgggtcgcggtggccgcggtcatggcggtcggcgccctcgccgcggccgcgatgggc
agccttgccctgcgccgtcacctgcacgcctga

DBGET integrated database retrieval system