KEGG   Frankia sp. EuI1c: FraEuI1c_6015Help
Entry
FraEuI1c_6015     CDS       T01354                                 

Definition
(GenBank) cell division ATP-binding protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
fri  Frankia sp. EuI1c
Pathway
fri02010  ABC transporters
Module
fri_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:fri00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FraEuI1c_6015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fri03036]
    FraEuI1c_6015
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fri02000]
    FraEuI1c_6015
Chromosome and associated proteins [BR:fri03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    FraEuI1c_6015
Transporters [BR:fri02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    FraEuI1c_6015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_22 AAA_29 AAA_33 AAA_18 RsgA_GTPase SMC_N AAA_25 Zeta_toxin AAA_5 cobW AAA_30 MMR_HSR1 NACHT AAA NB-ARC AAA_15 AAA_23 ATPase_2 RNA_helicase AAA_14 PIF1
Motif
Other DBs
NCBI-ProteinID: ADP83999
UniProt: E3IZT1
Position
complement(7401754..7402488)
Genome map
AA seq 244 aa AA seqDB search
MIRLDAVTMTYPAGSRPALRDVTLRIDAGEFVFLVGPSGSGKSTLLRLLLREERATSGLV
ALDGVDLAAIPDRRVPLLRRTIGCVFQDFRLLPDRTVAGNVAFALDVVGRPRHVVRTVVP
EVLGLVGLAGKENRYPDELSGGEQQRVAVARAMVGRPRVLLADEPTGNLDPATSEGIMRL
LDAVNRTGTTVVMATHNAALVDARRRRVVELADGVCVRDEQRGAYDGEDTGEVPLPANET
AGVR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatccggctcgacgcggtgacgatgacgtacccggccgggagcaggccggcactgcgc
gacgtcaccctgcgcatcgacgccggggagttcgtcttcctggtcggaccgtccggctcg
ggcaagtcgaccctgctgcgcctgctgctgcgggaggaacgcgcgaccagcggcctggtc
gccctcgacggggtggacctcgcggcgatccccgaccggcgggtgccgctgctgcgccgg
accatcggctgcgtcttccaggactttcggctgctgccggaccggaccgtcgccgggaac
gtcgccttcgcgctcgacgtcgtcggccgcccgcggcacgtggtgcgcacggtcgttccc
gaggtactcggactcgtgggcctcgcgggcaaggagaaccgttaccccgacgagctgtcc
ggcggcgagcagcaacgggtcgcggtggcccgggcgatggtcgggcggccccgggtgctg
ctcgccgacgagccgaccggcaacctcgacccggcgaccagcgaggggatcatgcggctg
ctcgacgcggtcaaccggaccgggacgaccgtcgtcatggccacccacaacgccgcgctg
gtcgacgcccgccgccgccgggtcgtcgaactcgccgacggggtctgcgtccgggacgag
cagcgcggcgcctacgacggcgaggacaccggcgaggtgcctctgccggcgaatgagacg
gctggggtgcgctag

DBGET integrated database retrieval system