KEGG   Frankia sp. EuI1c: FraEuI1c_6017Help
Entry
FraEuI1c_6017     CDS       T01354                                 

Definition
(GenBank) putative oxidoreductase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSDH NHL
Motif
Other DBs
NCBI-ProteinID: ADP84001
UniProt: E3J0T7
Position
7402983..7404239
Genome map
AA seq 418 aa AA seqDB search
MTRSCEPGRATISGARRAAGAVAAGILAAVLAACSGGGSSNPPAASPSTGTAAATTPHPP
ATGSQAADVVIATGLRSPWGLAFLPNRDVLVGERDSGQIMLLPTDPAVSSGYGKPRLLGT
VPDVHHAGEGGLLGLAVSPTFAADQLVYAYLTTNTDNRIVRFTLDGGDAGTLPRLGAPHP
ILTGLAAGTFHDGGRIAFGPDGMLYAGVGDATEPSRSQNLASLNGKILRMRPDGSVPPGN
PFPNSLVYSYGHRNVQGLAWDSAGRLWETEFGQNRWDEINLIRPGANYGWPLVEGIGDTQ
GGRFANPVVTWPVDQASPSGAAIIDDTLYAAALRGQRIWSVDLRPSLDAAPALTTASSGS
GSAGAALQVGTPQALRATAYGRLRTLAVAPDGTLWVTTSNTDSRGKPAPDDDRVISLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggagttgcgagccagggcgagcgaccatctcgggtgcacggcgggccgcagga
gccgtcgcggcgggcatcctcgccgccgtcctggccgcctgctccggtgggggatcgtcc
aacccgcctgccgcgtcgccgagcaccggtactgccgccgccacgacgccacacccgccg
gcgaccgggtcgcaagcggcggacgtcgtgatcgccaccgggctgcggtccccgtggggc
ctggccttcctgccgaaccgggacgtactggtcggagaacgcgacagcggccagatcatg
ctcctgcccaccgatccggcggtgtcctccggctacgggaagccacgcctgctcggcacg
gtgcccgacgtccatcacgccggtgagggcggcctgctgggcctcgccgtctcgcccacc
ttcgccgccgaccagctcgtctacgcctacctgacgacgaacacggacaaccggatcgtc
cgtttcaccctcgacggaggcgacgcgggcacgctgccgcggctcggcgcgccgcacccg
atcctcaccgggctcgccgcggggaccttccatgacggaggccggatcgcgttcggcccg
gacggaatgctctacgccggagtcggcgacgccaccgagccgtcacgctcgcagaacctc
gcaagcctgaacggcaagatcctgcggatgcgcccggacggctccgtcccgcccggcaat
cccttcccgaactcgctggtctacagctacggccaccgcaacgtgcagggcctggcctgg
gacagcgccgggcggttgtgggagaccgagttcggccagaaccgctgggacgagatcaac
ctgatccgcccgggcgcgaactacggctggccgctcgtcgagggcatcggcgacacccag
ggcgggaggttcgcgaacccggtggtgacctggccggtcgaccaggcgtcacccagcggg
gcggcgatcatcgacgacacgctctacgcggcggcgctgcgcggccagcggatctggtcg
gtcgacctgcggcccagcctcgacgccgccccggcactcaccaccgcgtcctccgggagt
ggctccgccggcgccgccctgcaggtcggcacgccgcaggcactgcgcgccaccgcctac
ggccggttgcgcaccctggccgtcgctcccgacggcacgctgtgggtcaccacgagcaac
accgacagccgtggcaagcccgcaccggacgacgaccgcgtcatctccctgcgctga

DBGET integrated database retrieval system