KEGG   Frankia sp. EuI1c: FraEuI1c_6018Help
Entry
FraEuI1c_6018     CDS       T01354                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K02303  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00860  Porphyrin and chlorophyll metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FraEuI1c_6018
Enzymes [BR:fri01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     FraEuI1c_6018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADP84002
UniProt: E3J0T8
Position
complement(7404307..7405089)
Genome map
AA seq 260 aa AA seqDB search
MTGHDVARPGGVGWVALVGGGPGAADLITVRGRDLLRRADVVVVDRLAPRELLADLGPEV
EIVDAAKGPHGHNLSQDEINSLLVERALRGLRVVRLKGGDPFLFGRGGEEALACAAVGVP
CEVVPGVTSAVAVPALAGIPVTHRGITQDLAVVSGHVDPSHPGSTSNWDALAAGPGTVVV
LMGVAALPEISRELVKRGRPATTPVAVIQDGASSQQRVVTGTLADIAVAAEAAGVTSPAV
IVIGEVVALREELETYRIPD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtcacgacgtggcccggccgggtggcgtcggctgggtggcgctggtcggcggc
ggcccgggcgcggcggatctgatcaccgtgcgtggccgcgacctgctgcgccgggcggac
gtcgtcgtggtcgaccggctcgcgccccgcgagctgctcgccgacctcgggccagaggtc
gagatcgtcgacgccgccaaggggccgcacggccacaacctctcgcaggacgagatcaac
agtctgctcgtcgagcgcgcgctgcgcggcctgcgggtggtccggctcaagggcggagat
ccgttcctgttcggccgcggtggcgaggaggcactcgcctgcgccgccgtcggggtgccc
tgcgaggtcgtccccggtgtcaccagcgcggtcgccgttcctgcgctggccggcatcccg
gtgacccatcgaggcatcacccaggacctggctgtcgtctccggccatgtcgacccgtcg
catccgggatcgacgtcgaactgggacgcgctggcggctggcccgggaaccgtcgtcgtc
ctgatgggcgtggccgccctgcccgagatcagccgcgagctggtcaagcgaggccgtccg
gcgacgacgccggtggcggtcatccaggacggcgccagctcccagcagcgtgtcgtgacc
ggcaccctcgccgacatcgccgtggccgcggaggcggccggcgtcacctcacccgccgtc
atcgtgatcggtgaggtcgtcgccctgcgcgaggagctggagacctaccggattcccgac
tga

DBGET integrated database retrieval system