KEGG   Frankia sp. EuI1c: FraEuI1c_6037Help
Entry
FraEuI1c_6037     CDS       T01354                                 

Definition
(GenBank) SAF domain protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAF ChapFlgA RcpC Pea-VEAacid
Motif
Other DBs
NCBI-ProteinID: ADP84021
UniProt: E3J0V7
Position
complement(7425787..7426650)
Genome map
AA seq 287 aa AA seqDB search
MTDLAPALGPGSLPGGRGPSGRSADPIVPPSPPARRLGRRGWRDGRLIFGILIVLVSVVL
GARLFATADRTSAWVAAKADLPAGHVVSAGDLVTVRAQLSDATAGRYYPGRRLKEVVGGT
LARPVGAGDLISGSDFAGPDTAATRLVPIVVQAGRLPDLAPGDHVDVYVFQASGAVGAGD
ASSGTGGSGGTGNATGQSTATGQSTGVGTPAVGGAGAEVLVLHDVEFLGQQRIASGDRSL
TLRVPVDAAIRAVAASQSGRVDVVKLVRDGQGQVGATGPTAAPGYGR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctggcgcccgcgcttggcccagggtccctgccgggtgggcgcggtccctcc
ggaaggtcagcggacccgatcgtcccgccgtccccgccagctcgccggctcggccgccgc
ggctggcgggacggtcggctgatcttcggcattctgatcgtgctggtctcggtggtgctg
ggagcccggctgttcgcgaccgcggaccggacgtccgcctgggtggcggcgaaggccgac
ctgcccgccgggcacgttgtcagcgccggcgatctggtcaccgtgcgtgcccagctgtcc
gacgcgaccgcggggcgctactacccgggccggcggctgaaggaggtcgtcggcggcacg
ctcgcgcgcccggtcggcgccggcgacctgatcagcgggtccgacttcgcggggcccgac
accgcggccacccggctcgtcccgatcgtcgtccaggccggccgcctgcccgacctggcc
ccgggcgaccacgtcgacgtctacgtcttccaggcctccggggccgtcggtgccggcgac
gcgagcagcgggaccggcggttccggtggcacgggcaacgcgacgggccagtcgaccgcg
acgggccagtcgaccggcgtgggtactccggcggtcggcggtgccggcgccgaggtactg
gttcttcacgacgttgagttcctcggccagcagcggatcgccagcggcgatcggtcgctg
acgctgcgggtgccggtcgacgcggcgatccgcgcggtcgccgcgtcgcagagcggccgg
gtcgacgtcgtgaagctggtccgtgacgggcagggccaggtaggtgccaccggaccgacg
gccgcgccggggtacggccggtga

DBGET integrated database retrieval system