KEGG   Frankia sp. EuI1c: FraEuI1c_6038Help
Entry
FraEuI1c_6038     CDS       T01354                                 

Definition
(GenBank) DNA binding domain protein, excisionase family
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 Phage_AlpA HTH_10 Tom37 HTH_26
Motif
Other DBs
NCBI-ProteinID: ADP84022
UniProt: E3J0V8
Position
7427133..7427369
Genome map
AA seq 78 aa AA seqDB search
MNDRFLQLSDVAEILNISASQTYALVRSGELPAIKIGGRGQWRVERTELEAYIQRAYEQT
RAFVLANPLSRHEAVPED
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgatttctgcagctcagcgacgtggcggagattctgaacatctcggcgtcg
cagacgtacgccctggtccgcagcggcgagctgccggcgatcaagatcggcggacgaggc
cagtggcgggtcgagcggaccgagctggaggcctacatccagcgcgcctacgagcagacg
cgggcgttcgtcctggccaacccgctcagccgccacgaggccgtccccgaggactag

DBGET integrated database retrieval system