KEGG   Frankia sp. EuI1c: FraEuI1c_6045Help
Entry
FraEuI1c_6045     CDS       T01354                                 

Definition
(GenBank) ribosomal subunit interface protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S30AE Ribosom_S30AE_C
Motif
Other DBs
NCBI-ProteinID: ADP84029
UniProt: E3J0W5
Position
complement(7436213..7437064)
Genome map
AA seq 283 aa AA seqDB search
MDIVVKGRHTAVPERFRSHVETKLAKLERYDGKVIRVDVELSREPNKRMADVRERVELTV
YTRGPVIRAEAAAADPYSALDGAAGKLAERLRRASERRTDHKHGNNGHGRAYVGPPPIPH
DDLVAIPSNGRVDAGGGLPSPARTAESLPSGDGTRPAGNGVPSPAGKAHRQPGVKENGAG
RADAWDEDDPTPDGFEDRYDLPDRSPMLVRTKTHRAEPMTLDDALSNMELVGHDFYLFQD
AASGRASVVYRRRGYDYGVIHLIDADDPARASDEDREPAAVPS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggacattgtggtcaagggccggcacacggcggttccggaacggttccgcagtcacgtc
gagaccaagctcgcgaagcttgagcgctacgacggcaaggtcatccgggtcgatgtggaa
ctgtcccgggagcccaacaagcgcatggcggatgtccgggagcgcgtcgagctcacggtc
tacacgcgggggccggtgatccgcgccgaggcggccgcggccgacccctactcggcgctc
gacggcgctgccggcaagctggccgaacggctacgccgggcgtccgagcgtcgcaccgac
cacaagcacggcaacaacggccacgggcgcgcctacgtcgggccaccgccgatcccgcac
gacgatctcgtcgccatcccctccaacgggcgggtcgacgccggcggcgggctaccgtcg
cccgcccggaccgccgaatccctgccgtccggcgacgggacccgcccggccggcaacggc
gtaccgagtcccgccggcaaggcgcacaggcagcccggcgtgaaggagaacggcgcgggc
cgcgcggacgcgtgggacgaggacgaccccacgcccgacgggttcgaggaccgctacgac
ctgccggaccgctcgcccatgctggtgcggacgaagacccaccgggccgagccgatgacg
ctggacgacgcgctgtcgaacatggagctggtcggccacgacttctacttgttccaggac
gccgcctccgggcgcgccagcgtcgtctaccgccgccgcggttacgactacggcgtcatc
cacctgatcgacgccgacgatccggcgcgggcctccgatgaggaccgtgaaccggcggcc
gtcccgagctga

DBGET integrated database retrieval system