KEGG   Frankia sp. EuI1c: FraEuI1c_6054Help
Entry
FraEuI1c_6054     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF95 transmembrane
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIM
Motif
Other DBs
NCBI-ProteinID: ADP84038
UniProt: E3J0X4
Position
7447548..7448570
Genome map
AA seq 340 aa AA seqDB search
MDLDAYVAVHRPEWFRLSHLVDKANRPRKMSRSELDELVELYQRVATQLSVVRGRSHDQA
MVDDLSSLVIRARAAVTGGAETSWRSVGRYFVATFPSAVYVRRWWVIGTTVGSVLLALAC
ALWITHDTNARENLVPPSDVAALCQHDFKAYYSENPASSFAGQVWTNNAWVSAEAIASGV
ALGLPTLFVLLNNAINIGVDGGYMSSCGHGGEFFSLILPHGLLELTVVFTAGAVGLKLGW
SIISPGGRRRVESLATEGRAALSIALGLAVALAVSGVIEAFVTPSGLPTAVRIGIGALAW
SLFVGYVWLYGSRAAATGDTGDLDAELAGDLVPVTEAVTL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggatctggacgcgtatgtagccgtccatcgaccggagtggttccggctcagccacctc
gtcgacaaggcgaaccggccgcgcaagatgtcgcgttcggagctcgacgagctggtcgag
ctctaccagcgtgtcgccacccagctttcggtggtccgcggccggtcccacgaccaggcc
atggtcgacgacctgtcgtcactcgtgatccgggcccgggccgccgtgaccggcggcgcc
gagaccagctggcggagcgtcggccggtacttcgtcgccaccttcccttcggcggtctac
gtccgccgatggtgggtgatcgggacgacggtcggatccgtgctgctcgcgctggcctgc
gctctgtggatcacacacgacacgaacgcccgggagaacctggtcccaccgagcgacgtg
gccgcgctctgccagcacgacttcaaggcgtactacagcgagaacccggcgagctcgttc
gccggccaggtctggacgaacaacgcctgggtctcggcggaggcgatcgcgtccggcgtg
gcgctgggcctgcccaccctgttcgtcctgctcaacaacgcgatcaacatcggagtcgac
ggcggctacatgtccagctgtggtcacggcggcgagttcttctcgctgatcctgccgcac
ggcctgctggagctgacggtcgtcttcaccgccggcgccgtcgggctgaagctcggctgg
tcgatcatctctcccggcggccgacgacgcgtcgagtcgctggccaccgagggccgggca
gcgctgtcgatagcgctcgggctcgccgtcgcgctggccgtctccggggtgatcgaggcc
ttcgtcaccccgtctggcctgccgaccgcggtccggatcgggatcggcgccctcgcctgg
tcgctgttcgtcggctacgtctggctctacggctcccgcgccgcggcgaccggcgacacc
ggcgatctcgacgccgaactggccggcgatctcgtgcccgtcaccgaggcggtgaccctg
tga

DBGET integrated database retrieval system