KEGG   Frankia sp. EuI1c: FraEuI1c_6059Help
Entry
FraEuI1c_6059     CDS       T01354                                 

Definition
(GenBank) Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase-like protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bact-PGI_C SIS SIS_2
Motif
Other DBs
NCBI-ProteinID: ADP84043
UniProt: E3J0X9
Position
complement(7454545..7455696)
Genome map
AA seq 383 aa AA seqDB search
MYVDESVLDDPARLAVADPGDLLRELATGGRQIRETWRLAEEAGAAQLGADGRPRAVLVV
GTGAAAGAADVLVAAAGAVSPVPVIGHHDHGLPGWVGVADVVLAVSGSGRSPLTLTAVED
AARRGCRILAVGPPDTPLHYLADRARAPFVKIDGTRPERASLWALATPLLAVGAALGVCR
DAAAGVEAAAARLEEIAGRSRPSSESFVNPAKLLALELAGTLPIIWGTSQATSAAASRAA
TQLAVTAKYPVLHGGLPHPGIYQIAAFDGVFGARAAAADAGNDELDEFFRDRVDDEMTTR
LRLILLRDPGHEHPDVTRRAEAVVRVAAERGVGVTELSATGSHPVERMASLVGLLDYASV
YLAMLIGIDPSLEPAIHDLDRVR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgtcgacgaaagcgtcctggacgacccggcgcgactggccgtggccgaccccggg
gacctgctgcgggagctcgcgaccggcggccggcagatccgggagacttggcgcctcgcc
gaggaggccggagcggcccagctcggtgccgacgggcggccccgggccgtcctggtcgtc
ggcaccggggccgccgccggcgcggccgacgtgctcgtcgccgcggccggcgccgtcagc
cccgtcccggtcatcggccatcacgatcatggactgcccggctgggtaggcgtggccgac
gtcgttctcgccgtctccggctctggacgttcgccgctgaccctgaccgcggtcgaggac
gcggctcgccgcggctgccgcatcctcgccgtcggcccgcccgacacccccttgcactac
ctggccgaccgggccagggcgcccttcgtcaagatcgatggcacccggccggagcgggcc
agcctgtgggcgctggccaccccgctgctggccgtgggcgcagcgctgggggtctgccgg
gacgccgccgccggcgtcgaggcggccgcggcccggctggaggagatcgccgggcgcagc
cggccgtccagcgagtcgttcgtcaacccggcgaagctgctcgccttggagctggccggc
acccttccgatcatctggggcacctcgcaggcgacctcggcggcggccagccgggcggcc
acccagctcgccgtcacggcgaagtacccggtgctgcacggcggcctgccgcacccgggg
atctaccagatcgccgccttcgacggcgtcttcggcgcccgcgccgcggcggccgacgcc
gggaacgacgagctcgacgagttcttccgggaccgggtcgacgacgagatgaccacccgg
ctgcggctgatcctgctgcgcgacccggggcacgagcatccggacgtgacccgccgcgcg
gaggcggtcgtccgggtcgccgccgagcgcggggtcggggtcaccgagctgtccgcgacg
ggcagccacccggtcgagcggatggcctccctggtcggcctgctggactacgcgtcggtc
tacctggcgatgctgatcggcatcgacccgagcctcgaaccagccatccacgacctcgac
cgcgtccgctga

DBGET integrated database retrieval system