KEGG   Frankia sp. EuI1c: FraEuI1c_6060Help
Entry
FraEuI1c_6060     CDS       T01354                                 

Definition
(GenBank) protein of unknown function DUF343
  KO
K09791  uncharacterized protein
Organism
fri  Frankia sp. EuI1c
Brite
KEGG Orthology (KO) [BR:fri00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    FraEuI1c_6060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trm112p
Motif
Other DBs
NCBI-ProteinID: ADP84044
UniProt: E3J0Y0
Position
complement(7455803..7456006)
Genome map
AA seq 67 aa AA seqDB search
MSLDPLLLEILACPCPQHAPLRQDTLAGAPVLVCTACNLAFPVRDDIPVMLLDEASPFPE
AAAPATS
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgatccgctgcttttggagatcctcgcctgcccgtgtccgcagcacgccccg
ctgcgtcaggacacgctggccggcgccccggtcctcgtctgcaccgcctgcaacctggcg
ttcccggtgcgcgacgacattccggtgatgctgctcgacgaagcgagtccgttcccggag
gccgccgccccggcgacgtcctga

DBGET integrated database retrieval system