KEGG   Frankia sp. EuI1c: FraEuI1c_6061Help
Entry
FraEuI1c_6061     CDS       T01354                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00051  Fructose and mannose metabolism
fri00520  Amino sugar and nucleotide sugar metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FraEuI1c_6061
   00520 Amino sugar and nucleotide sugar metabolism
    FraEuI1c_6061
Enzymes [BR:fri01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     FraEuI1c_6061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Reovirus_M2
Motif
Other DBs
NCBI-ProteinID: ADP84045
UniProt: E3J0Y1
Position
complement(7456015..7457373)
Genome map
AA seq 452 aa AA seqDB search
MGLDLARIFKAYDVRGVVPSEFDADIARATGAAFVRLLDAKEIVIAHDMRESSGPLSAAF
AEGATSQGADVVLAGLGSTDLLYFAAGSLNLPGAMFTASHNPAKYNGIKMCRAGAAPIGQ
ETGLAEIRDMVATGVPAYTGTPGSVREVDLLEAYVAHLRTLVDLSGIRPLKVVVDAGNGM
GGYTVPAALAGLPLDVVPLYFELDGSFPNHEANPIEPENLRDLQKAVRDSGADIGLAFDG
DADRCFVVDERGELVTPSTITALVAERELAREPGGTIIHNVIVSKAVPELVRKLGAVPVR
TRVGHSFIKGEMARTGAIFGGEHSGHFYFRDFWRADSGMLAALHVLAALGGQAGPLSALL
DGYAPYAVSGEINSEVADAAASMKAIEAEYAHKATDIDHLDGLTISLADGSWFNLRPSNT
EPLLRLNVEAGDDDTMSRLRDEVLASIRGGRD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggggcttgacctcgcccggatcttcaaggcgtatgacgtgcgcggggtcgtgccgtcc
gagttcgacgcggacatcgctcgcgccaccggcgcggcgttcgtccggctgttggacgcc
aaggagatcgtgatcgcgcacgacatgcgcgagtcgtccggtccgctgtccgcggcgttc
gccgagggcgccacgagccagggcgccgacgtcgtgctcgccgggctcgggtcgacggac
ctgctgtacttcgccgccggctcgctgaacctgccgggcgcgatgttcaccgcgtcgcac
aacccggccaagtacaacggcatcaagatgtgccgcgccggcgccgcgcccatcgggcag
gagaccggtctggccgagatccgcgacatggtcgcgaccggggtccccgcgtacaccgga
acgcccggctcggtccgcgaggtggacctgctggaggcctacgtcgcccacctgcgcacg
ctggtcgacctgtccggcatccggccgctgaaggtcgtggtcgacgccggcaacggcatg
ggcggctacaccgtgccggcggccctcgccggcctgccgctcgacgtcgtcccgctctac
ttcgagctggacggcagcttcccgaaccacgaggcgaacccgatcgagccggagaacctg
cgcgacctgcagaaggccgtccgcgacagcggcgccgacatcggcctcgccttcgacggc
gacgccgaccgctgcttcgtcgtcgacgagcgcggcgagctggtcaccccatccaccatc
accgcgctggtcgcggagcgggagctcgcccgcgagcctggcgggaccatcatccacaac
gtgatcgtcagcaaggcggtcccggagctggtccgcaagctcggcgccgtcccggtgcgc
acccgcgtcgggcactcgttcatcaagggtgagatggcccggacgggcgccatcttcggc
ggcgagcactcgggccacttctacttccgggacttctggcgggccgactcggggatgctc
gcggccctgcacgtcctcgccgcgctcggcggccaggccggcccgctctcggccctgctc
gacggctacgctccgtacgccgtgtccggggagatcaactcggaggtcgccgacgcggcc
gcgtcgatgaaggccatcgaggccgagtacgcgcacaaggccaccgatatcgaccacctg
gacggcctgaccatctcgctcgcggacggctcgtggttcaacctgcggccgtccaacacc
gaaccgctgctgcgcctcaacgtcgaggcgggggatgatgacaccatgagccggctgagg
gacgaggtcctggccagcatccgtggtggaagggactga

DBGET integrated database retrieval system