KEGG   Frankia sp. EuI1c: FraEuI1c_6079Help
Entry
FraEuI1c_6079     CDS       T01354                                 

Definition
(GenBank) hypothetical protein
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2079 DUF3309 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ADP84063
UniProt: E3J0Z9
Position
complement(7481142..7481477)
Genome map
AA seq 111 aa AA seqDB search
MRAQRALAILLTVLFFGLVVFGLGALFAVFHERTWGYVIGGFACVVMVYAGISSLRGSDG
ASPRPGTGKAPDRAGGAKPAGKRGAGGKTAGGRGNNSAGAGSDRSGRTGRR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggcccagcgggcgctcgccattctgctgaccgtgctgttcttcggcctggtcgtc
ttcggcctcggcgcgctgttcgcggtctttcacgagcggacctggggctacgtgatcggc
gggttcgcctgcgtcgtgatggtctacgccgggatcagctccctacgtgggtccgatggc
gcaagcccgcggccgggcaccggcaaggcgcctgaccgcgccgggggcgccaagcccgcc
ggcaagcgtggcgctggtggcaagaccgctggtgggcgcgggaacaactccgccggcgcc
ggttccgaccgttccggtcgaaccgggcgacgctga

DBGET integrated database retrieval system