KEGG   Frankia sp. EuI1c: FraEuI1c_6161Help
Entry
FraEuI1c_6161     CDS       T01354                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fri  Frankia sp. EuI1c
Pathway
fri00020  Citrate cycle (TCA cycle)
fri00640  Propanoate metabolism
fri00660  C5-Branched dibasic acid metabolism
fri01100  Metabolic pathways
fri01110  Biosynthesis of secondary metabolites
fri01120  Microbial metabolism in diverse environments
fri01130  Biosynthesis of antibiotics
fri01200  Carbon metabolism
Module
fri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fri00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FraEuI1c_6161
   00640 Propanoate metabolism
    FraEuI1c_6161
   00660 C5-Branched dibasic acid metabolism
    FraEuI1c_6161
Enzymes [BR:fri01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FraEuI1c_6161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADP84145
UniProt: E3J240
Position
complement(7595511..7596677)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKALFAEHGVPVPTGKTAATPEEARAIAAELGGKVVVKAQVKAGGRGKAGGVK
VADGPDDAFEKASAILGMDIKGHTVHSVLVEQASNIAEEYYASFLLDRANRTFLAMASRE
GGMEIEEVAATKPEALARIHIDPLAGVDLAKAREIAVAAKLPEAALDGAAELLTKLWEVF
VQADATLVEVNPLILTGEGTVVALDGKVSLDENADFRHPENEALVDNSAVDPLEQKAKEK
GLNYVKLTGEVGIIGNGAGLVMSTLDVVTYAGEEFGGKRPANFLDIGGGASAEVMANGLS
IILSDPSVKSVFVNIFGGITACDAVANGIIKALELVGDITTPLVVRLDGNNAEEGRRILA
EANLPVVKPVDTMDGAAKLAAELAAAAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgaataccaggcgaaggccctcttcgccgaacatggcgtcccggtgccc
accggcaagaccgccgccaccccggaagaagcccgcgcgatcgccgcggagctaggcggc
aaggtcgtcgtcaaggcccaggtgaaggccggtggccgcggcaaggccggcggcgtgaag
gtcgccgacgggccggacgacgccttcgagaaggccagcgccatcctcgggatggacatc
aagggccacaccgtgcactcggtgctcgtcgagcaggccagcaacatcgcggaggagtac
tacgcgtcgttcctgctggaccgcgcgaaccgtaccttcctggcgatggcgtcccgcgaa
ggtggcatggagatcgaggaggtcgccgccaccaagcccgaggcgctcgcccgtatccac
atcgacccactggccggcgtcgacctggcgaaggcccgtgagatcgccgtcgccgccaag
ctccccgaggccgccctcgacggcgccgccgagctgctcaccaagctctgggaggtgttc
gtccaggcggacgccaccctggtcgaggtcaacccgctgatcctgaccggcgagggcacg
gtcgtcgccctcgacggcaaggtctcgctggacgagaacgccgacttccggcacccggag
aacgaggcgctcgtcgacaactccgcggtcgacccgctggagcagaaggcgaaggaaaag
ggcctcaactacgtcaagctgaccggtgaggtcggcatcatcggcaacggcgccggcctg
gtcatgtcgaccctggacgtcgtcacctacgccggtgaggagttcggcgggaagcgcccg
gcgaacttcctcgacatcggcggcggcgcctcggccgaagtcatggcgaacggcctttcg
atcattctttccgacccgtcggtgaagagcgtcttcgtcaacatcttcggcggtatcacc
gcctgtgacgcggtcgccaacggcatcatcaaggcgctcgagctggtgggcgacatcacc
accccgctggtcgttcgcctggacggcaacaacgccgaggaaggccgacgcatcctcgcc
gaggccaatctcccggttgtgaagccggtcgacaccatggatggcgcggccaagctcgcc
gccgagctcgccgccgccgcggcctga

DBGET integrated database retrieval system