KEGG   Francisella sp. MA067296: BBG19_0153Help
Entry
BBG19_0153        CDS       T05204                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
frm  Francisella sp. MA067296
Pathway
frm00230  Purine metabolism
frm00250  Alanine, aspartate and glutamate metabolism
frm01100  Metabolic pathways
Module
frm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:frm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BBG19_0153
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBG19_0153
Enzymes [BR:frm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BBG19_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: APC90891
Position
158725..160011
Genome map
AA seq 428 aa AA seqDB search
MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVL
HQHTKCVIGHGVVLDPVALDEEITRLQATGIAISAENLFVSESCTIITSYHKLLDAVRES
NTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDILRSRLAISLAEKEILFRDLYKVEY
PTLEQEFDKLFALGQKLKQYAVDTFSIIDQAIAAGKNIVYEGAQGVLLDVDYGTYPFVTS
SNTSVAGVYSGATTAGHSLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVT
TGRIRRCGWLDLPLLKYSAKCSNLTSIALTKVDVLSDMETLKVCIGYKYEGREIYCAYPG
IDLYKVEPILVDMKPFSIDETVTKDNIPAALKTYLKTIENHIGIPISSLAYGPSREQILF
FEDYFKKG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatatcgtaatcgtaggcgctcagtggggtgatgaaggtaaaggtaaaatagca
gatactttagctgagaaagcagatttggttgtacgctatcaaggcggtaataatgctggc
catacgttggttgtaaatggtaagaagacatttcttcatctgataccttcaggggtttta
catcagcatacaaaatgtgtaattggtcatggtgtggttttagaccctgttgccttagat
gaggagattacgcgtttacaagcaacaggcatagcaatctcagcagagaatttatttgtt
tctgaatcttgtacaattattacttcttatcataagcttttagatgcagttagagaaagt
aatactagtgaaaaaataggtacaactggtaaaggtattggtccagcatacgaggacaaa
gtatcgcgtaaaggtatcaaatttaagcatctatttgataaagatatattaaggtcaaga
ttagctatatctcttgcagagaaagaaattttatttagagatttatataaagttgaatat
ccaacattagaacaagagtttgataagctttttgctttaggtcaaaaacttaaacagtat
gcagtagatactttttcaataatagatcaagcaattgcagcaggtaaaaatattgtttat
gaaggtgcacaaggtgtgcttttagatgttgattatggtacttatccatttgtgacatct
tctaatacttcagtggcgggtgtatattctggagcaacaactgctgggcatagtttagat
catgtgattgggattacaaaagcttatacgacaagagttggtgaaggacctttcccaacg
gagctttttgatgatgtcggtaaatttattcagcataagggcggtgaaataggcgtaaca
acaggtagaatccgtaggtgtggttggttagatttacctcttttaaaatactcagcaaaa
tgctcaaacttaacatcaatagccttaacaaaagttgatgttttatctgatatggagaca
ctaaaagtttgtattggttataagtatgagggtagagaaatatattgtgcttatcctggt
atagatttatacaaggttgagccaattcttgttgatatgaagccgttttctattgatgaa
actgtaacaaaagataatataccagctgcacttaaaacatatctgaaaactatagagaat
catataggtattccaatatcttcattagcatatggaccatctagagaacaaattttattc
tttgaggattatttcaaaaagggttaa

DBGET integrated database retrieval system